KEGG   Paenibacillus riograndensis: PRIO_3659Help
Entry
PRIO_3659         CDS       T03849                                 

Gene name
npr
Definition
(GenBank) Bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
pri  Paenibacillus riograndensis
Brite
KEGG Orthology (KO) [BR:pri00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pri01002]
    PRIO_3659 (npr)
Enzymes [BR:pri01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     PRIO_3659 (npr)
Peptidases [BR:pri01002]
 Metallo Peptidases
  Family M4: thermolysin family
   PRIO_3659 (npr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: CQR56062
UniProt: A0A0E4HAV4
LinkDB All DBs
Position
I:4289441..4291045
Genome map
AA seq 534 aa AA seqDB search
MKKSLASLLSGIVALGSFASVGIAAESTERSQPAELFTGSTPISITGQSLKTPAGDGSEE
QVYKYLESVKGNLHLSSKDNIRGKFQIKEQQTNSKTGSQHYRLSQYINGIPVYGADQTLH
IDKSGNVTSLLGTVVEDVYQTIPQPLVQLKTISDTEAISAAVTDATQQYGPLGEAQIAPE
ADLYYFIVGGEPKLAYKTEVNVLEPEPLRIRYFISAEDGTVLFKYNILEDLTGTGTGVNG
DTKTFETRLSGSTYQLYDNTRGKGIVTYTAKNRTTLPGTLLTSSTNVWSDRAGVDAHTYA
ERTYDYYLQHFGRNSLDNKGLQIRSSVHYYTSYNNAFWNGSQIVFGDGDGTTFTLLSGDL
DVVGHELTHGVTENTANLEYYGEPGALNESFSDIIGNSIEGENWLVGDKVYTPGIPGDAL
RSLANPTLYGQPDKYSDRYTGSSDNGGVHTNSGINNKAFYLVAQGGTFNGVTVAGIGRED
AVQIYYNALVYYLTTSSDFSAARAAVIQSATELFGAGSAQVTAVTQAYNAVGVY
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagtttagcttcccttctttctggcattgtagcgttaggttcatttgcatcc
gttggtatcgcagccgagagcactgaacgcagtcaacccgctgagctattcactggttct
acccctatatcaattacgggccagtcgttgaaaactccagcgggtgatggttcagaggaa
caggtatataaatacctggaaagtgtcaaaggcaacctgcatctgtcctccaaggataac
atccgtggaaaatttcaaattaaggagcagcagacaaacagcaaaacaggcagccagcac
tatcggttaagccaatatattaacggaatcccggtgtatggagcggatcagacacttcat
atcgacaaaagcggcaacgttacttcactgctcggaactgtagttgaggatgtatatcag
accattccgcagccgcttgttcagctcaaaaccatatccgacaccgaggctatctccgct
gccgtaactgatgctacccagcagtatggtcctcttggcgaagcgcaaattgcgcctgaa
gcggatttgtattattttatcgtgggtggtgaaccgaaactggcttacaagacagaagtt
aatgtgctcgaacccgagccgctgcggatccggtacttcatctctgcagaagacggaacc
gtgctgttcaaatacaatattctggaagatctgaccggtacgggcacaggggtcaatggc
gatactaaaactttcgagacgcggctctccggctcaacctatcagctgtatgacaacacg
cggggcaaaggcatcgttacctacacggccaagaaccgtaccactcttccgggtacattg
ctgaccagttctacaaatgtatggtcggatagagccggtgtcgatgcccatacgtatgcg
gaaagaacctacgattattatctccagcattttgggcgcaacagcctagacaacaagggg
ctgcagattcgatccagtgtccattattatacttcctataacaacgcattttggaatggt
tcgcagatcgtctttggggatggggacggtactacatttactcttttatccggggacttg
gatgttgtgggacatgagcttacacatggcgtgaccgagaacacagccaatcttgaatac
tacggcgaaccgggagctctgaatgaatccttctccgacatcatcggaaactccatcgaa
ggggaaaactggctggtaggtgataaggtctatacaccgggtataccaggtgacgcactg
cgttcactggccaatccaacgctctacggacagcctgacaaatacagcgaccggtatacc
ggaagcagtgataacggcggtgtgcatacgaacagcggcatcaataacaaggccttttat
ctggttgcccagggtggtacgttcaacggagtgacagtagcgggaattggccgcgaggac
gctgttcaaatctattacaatgcactggtctattatcttaccacctcttctgacttctcc
gctgcccgcgcagcagtcatccaatctgccactgagctgtttggagcaggctcggctcag
gttacggctgtgactcaagcgtataatgcggttggggtgtattaa

DBGET integrated database retrieval system