KEGG   Paenibacillus riograndensis: PRIO_5622Help
Entry
PRIO_5622         CDS       T03849                                 

Gene name
sdhB
Definition
(GenBank) Succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pri  Paenibacillus riograndensis
Pathway
pri00020  Citrate cycle (TCA cycle)
pri00190  Oxidative phosphorylation
pri00650  Butanoate metabolism
pri01100  Metabolic pathways
pri01110  Biosynthesis of secondary metabolites
pri01120  Microbial metabolism in diverse environments
pri01130  Biosynthesis of antibiotics
pri01200  Carbon metabolism
Module
pri_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pri_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PRIO_5622 (sdhB)
   00650 Butanoate metabolism
    PRIO_5622 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PRIO_5622 (sdhB)
Enzymes [BR:pri01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PRIO_5622 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     PRIO_5622 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_17 Fer4_2 Fer4 Fer4_15 Fer4_13 Fer4_6 Fer4_18 Fer4_3 Fer4_21 Fer4_4 Fer4_16
Motif
Other DBs
NCBI-ProteinID: CQR58009
UniProt: A0A0E4HED6
LinkDB All DBs
Position
I:complement(6541093..6541857)
Genome map
AA seq 254 aa AA seqDB search
MAETAAAPKNVKFVITRQDEPDTAPYTEEFELAYRPGMNVISALMEIQRNPVNAKGDSTV
PVCWESNCLEEVCGACSMVINGKPRQACAALIDNLEQPVRIEPMRTFPVVRDLVIDRSRM
FGALKRVKAWIPIDGTYDLGPGPRMAEKKRQWAYELSKCMTCGVCLEACPNVNEKTNFIG
PAAISQVRLFNAHPTGEMNADERLDALMEDGGIDGCGNSQNCVRACPKGIPLTTSIAEIN
KQTTKHMFKRWLGV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaactgctgcagctcccaaaaacgtaaaatttgtgattacccgccaggacgaa
ccggacacggccccttatacggaagagttcgagcttgcataccgtccggggatgaacgtg
atcagcgctttgatggagattcagcgcaacccggttaatgccaagggcgacagtacggtt
ccggtctgctgggaatccaactgtctggaggaagtgtgcggggcctgctcaatggtcatc
aacggcaagcctcgccaggcctgcgccgccctgatcgataatctggagcagccggtgcgc
atcgagccgatgagaaccttcccggtggtgcgtgacctggtgattgaccgcagccggatg
tttggtgcgctcaaacgggtcaaggcgtggattccgatcgacggcacctacgacctcggt
cctggtccgcgcatggcggagaagaagcgtcaatgggcgtatgagctgtccaagtgcatg
acctgcggcgtctgcctggaagcctgccctaacgtcaatgaaaaaactaatttcatcggc
ccggcggccatttcacaggtccgtctgttcaacgcccatcctacaggcgagatgaatgcc
gatgagcgcctggatgcgctgatggaagacgggggcattgacggctgcggcaactcgcag
aactgcgtgcgcgcctgcccgaaaggcattccgctcaccacgtccattgccgagatcaac
aaacagaccaccaagcatatgttcaagcgctggctgggtgtgtaa

DBGET integrated database retrieval system