KEGG   Paenibacillus riograndensis: PRIO_5623Help
Entry
PRIO_5623         CDS       T03849                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pri  Paenibacillus riograndensis
Pathway
pri00020  Citrate cycle (TCA cycle)
pri00190  Oxidative phosphorylation
pri00650  Butanoate metabolism
pri01100  Metabolic pathways
pri01110  Biosynthesis of secondary metabolites
pri01120  Microbial metabolism in diverse environments
pri01130  Biosynthesis of antibiotics
pri01200  Carbon metabolism
Module
pri_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pri_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PRIO_5623 (sdhA)
   00650 Butanoate metabolism
    PRIO_5623 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PRIO_5623 (sdhA)
Enzymes [BR:pri01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PRIO_5623 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     PRIO_5623 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 HI0933_like FAD_oxidored GIDA AlaDh_PNT_C NAD_binding_8 DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CQR58010
UniProt: A0A0E4HDE4
LinkDB All DBs
Position
I:complement(6542161..6543903)
Genome map
AA seq 580 aa AA seqDB search
MASADIIIVGGGLAGLMATIKAAESGAHVHLFSLVPVKRSHSVCAQGGINGAVNTKGEGD
SPWEHFDDTVYGGDFLANQPPVKAMCEAAPGIIHLMDRMGVMFNRTPEGLLDFRRFGGTK
RHRTAFAGATTGQQLLYALDEQVRRWEAEGMVTKSENWEFLSVILDDERVCRGISAQNLK
TMEIQTFPADAVILASGGPGIIFGKTTNSVINTGTAASAVYQQGVYYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPSYGNLVPRDIATREIFNVCVDQG
LGINGENMVYLDLSHKDPKELDVKLGGIIEIYEKFMGDDPRKIPMKIFPAVHYSMGGMWV
DYNQMTNIPGLFAAGECEYQYHGANRLGANSLVSAIYGGMVSGPKAVEYIKGLKKSVQDI
SSTVFDSFHKTQTDKYESLLAMSGTENAYVIHKELGEWMTANMTVVRENTKLTATIGKIK
ELKERYRRINMNDTSRWNNQGVAFTRQLWNMLELSEAMTLGALLRNESRGAHYKPEFPAR
NDEEFLKTTKAAWTADGPQISYEEVDVSLIPPRVRDYSKD
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggcatcagccgatatcattatcgtgggcggggggctggccggcctgatggctaccatc
aaggcggcagaatccggcgcgcatgtgcatctattctcccttgttcctgtcaaaagatcg
cattcggtctgcgcgcaaggcggcatcaacggagcggtgaacaccaaaggcgagggagac
tcgccctgggagcatttcgacgatactgtgtacggcggcgatttccttgccaaccagcct
ccggtgaaggcgatgtgcgaggccgcaccgggcatcatccatctgatggaccggatgggc
gtcatgttcaaccgcacgccggaggggctgcttgacttccgccggttcggcggcacgaag
cgccaccggacagcttttgcaggtgcgacgaccggccagcagctgctgtatgcgctggat
gagcaggtacgccgctgggaagccgaaggcatggtcaccaaaagcgagaactgggaattc
ctctcggtgatcctggacgatgagcgtgtatgccgcggcatcagtgcccagaatctcaag
acgatggagattcagacgttcccggcggatgcggtgattctggcgagcggcgggcccggc
attatttttggcaaaacaacgaactcggtcatcaacaccggaaccgctgccagcgctgta
tatcagcagggtgtatattacgccaacggcgaattcattcagatccaccccacagccatt
cccggcgatgacaagctgcggctgatgtcggaatcggcgcgcggtgaaggcggacgcatc
tggacctacaaggacggcaagccgtggtacttcctggaggagaaatatccttcttacggg
aatctggtgccgcgcgatattgcaacccgggagatttttaatgtatgtgtcgaccagggg
ctgggcattaacggcgagaacatggtatacctggatctctcccacaaggacccgaaagag
ctggacgtcaagctaggcggcattatcgaaatctatgagaaattcatgggcgatgatccc
cgcaaaattccgatgaaaatcttcccggctgtgcattactccatgggcggcatgtgggtc
gactacaaccaaatgaccaatattcccgggctgttcgcggcaggggaatgcgaataccaa
tatcacggcgcgaaccggctgggcgcgaactcgcttgtatcggcgatctacggcggcatg
gtctctgggccgaaggctgttgaatatattaaggggctgaagaaatcggtacaggacatt
tcctctaccgtctttgacagcttccataagacacaaaccgataaatacgagtctttgctg
gcgatgtcaggcacagagaatgcctatgtcatccataaagagctgggcgaatggatgacc
gccaacatgacggtggtgcgcgagaataccaagcttaccgccaccatcggcaaaattaaa
gagttgaaggaacgctaccgccggatcaacatgaacgatacgtcgcgctggaacaaccag
ggtgtggccttcacccgccagctgtggaacatgctggagttgtccgaggccatgaccctg
ggcgcgctgctgcgcaacgagagccgcggcgcgcactacaagccggaattccccgcccgc
aatgacgaggagttcctgaagaccaccaaggccgcatggacggcggacggcccgcaaatc
tcttacgaagaagtggatgtgtcgctgattcctccacgggtgcgggattactcgaaggat
tga

DBGET integrated database retrieval system