KEGG   Paenibacillus riograndensis: PRIO_6030Help
Entry
PRIO_6030         CDS       T03849                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pri  Paenibacillus riograndensis
Pathway
pri00620  Pyruvate metabolism
pri00680  Methane metabolism
pri01100  Metabolic pathways
pri01120  Microbial metabolism in diverse environments
pri01200  Carbon metabolism
Module
pri_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PRIO_6030
  09102 Energy metabolism
   00680 Methane metabolism
    PRIO_6030
Enzymes [BR:pri01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PRIO_6030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 OTCace
Motif
Other DBs
NCBI-ProteinID: CQR58399
UniProt: A0A0E4CZB2
LinkDB All DBs
Position
I:complement(7067850..7070642)
Genome map
AA seq 930 aa AA seqDB search
MTELTTAVSKSNSNNLLRRDVRFLGNILGEVLVHQGGNELLEIVEKIRETSKSLRSLFLP
ELHNEFKELINSLDPENRHQVIRAFAIYFQLVNIAEQNHRIRRKRDYERSAGETVQPGSI
ESAIQELRERDFSHEDVHEIMNGLSLELVMTAHPTEAMRRAILDIHKRISDDVMGLDNPT
LTFREREQLREKLLNEVITLWQTDELRDRKPTVLDEVRNGMYYFHETIFQVLPDVYQELE
RCLSKYYPGQNWHVPTYLRFGSWIGGDRDGNPSVTAAVTLQTLRLQRKLAIREYQRIMRE
LMQYLSFSTSIVKVTPELLQSIESDRDIIQLDKAKSWHNDNEPYRIKLAYMIAKTQNVMD
DEKKGTPERYASPEQFIDDLNVIDRSLRHHYADYVADTYIKKLIRQVELFGFHTATLDVR
QHSQEHENAMTEILAKMNVTQDYAKLQENEKIGLLEKLLNDPRPLTSPYQTYSESTEECL
AVYRAIFTAQEEYGKQCITSYLISMAEAASDILEVMVFSKEVGLFRKDNDGTVVCTLQAV
PLFETIDDLHNAPQIMRTLLNLPIYRDAVRAMNDLQEIMLGYSDSNKDGGVVTANYELRV
ALKEITTTADEFGIKLKFFHGRGGALGRGGMPLNRSILAQPASTIGGGIKITEQGEVISS
RYSMQGIAYRSLEQATSALITAAINARSPQADLYDPKWEEIVARISEVSLSKYQDLIFRD
PDFLNYFKESTPLPEVGELNIGSRPSKRKNSDRFEDLRAIPWVFAWTQSRYLLPAWYAAG
TGLQSFYDDKEENLKIMQHMYEKFSFFTTLIDTLQMAIAKADLIIAKEYAGMGKNEEARQ
RIFGQIEAEFKLTSELILKITGQQDILDNVPVIQESIRLRNPYVDPLSYLQVQLLSELRA
LREAEGDDAELLREVLLTINGIAAGLRNTG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacttacgactgccgtgagcaaaagcaactcaaacaatctgctgcggcgtgac
gtacggttcctggggaatattttgggcgaagtcttggttcaccaaggcggcaacgaactg
ctggagatcgtagagaagatccgcgaaaccagcaaatcgctgcgctcattgtttttgcct
gaactgcacaatgaattcaaggagctaatcaattcacttgatcctgagaatcgacaccag
gtgatacgggcgttcgctatttattttcaattggtgaacattgccgagcagaaccaccgg
attcgccgaaaacgcgactacgaacgttcagccggggagactgtacagcctggttctatc
gaaagcgcgattcaggagctccgcgagcgggatttctcacacgaggatgttcatgagatc
atgaacggcctgtctttggagctggtcatgacagctcaccctacggaagccatgcggcgg
gcgatccttgatattcataagcgtatctccgatgacgtgatgggtctggataaccctacc
ctgaccttccgggaacgcgaacagctgcgtgagaagctgctgaatgaagtcattaccttg
tggcagacggatgaactgcgtgaccgcaagcctacggtactggatgaagtccgcaatgga
atgtactatttccatgagacgatttttcaggtgctgccggatgtgtatcaagaacttgaa
cgatgtctgagcaaatattatccgggccagaattggcatgttccaacctatttgcgtttt
ggctcgtggatcggcggagaccgtgacggcaacccttcagtaaccgcggctgtgacctta
cagaccctgcgtttgcagcgcaagctggcgattcgggagtatcagcgcattatgcgcgaa
ctgatgcagtatctgagctttagtacaagcatcgtcaaagtaacgccggaactgctgcaa
tccattgaatcggatcgggacattattcaactggataaggcgaaatcctggcataatgat
aatgagccgtaccggattaagcttgcctatatgatcgcgaagacacagaacgttatggat
gatgagaaaaaaggtacacctgagcgctacgcttcaccggagcaatttatagatgatttg
aatgtgattgaccgcagtctgcgccatcactatgccgactatgttgcggatacctacatt
aagaaactgattcgtcaggtagagctgtttggattccataccgcgactcttgatgtccgc
cagcacagccaggagcatgaaaatgccatgacagagatcctggccaaaatgaatgttacg
caggattatgccaagctgcaggagaacgagaagatcgggcttctggaaaagctgctgaat
gatccgcgtccgctgacttcgccgtatcagacctacagcgaaagcacggaggaatgcctt
gctgtgtaccgtgccatttttacggcgcaagaggagtacggcaaacaatgtatcactagc
tacctcatcagtatggctgaagccgcgagcgatattctggaggttatggtgttctccaag
gaagtcggcttattccgcaaagacaacgatggaactgttgtttgcacacttcaggctgtg
ccgttgttcgaaaccattgacgatctgcataatgcaccgcaaatcatgcggacattgctc
aacctgccgatctaccgtgatgcggttagggcgatgaatgacctgcaggagatcatgctg
ggatattcggacagcaacaaggatggcggcgtagttaccgctaactatgagctgcgggtg
gcactcaaggaaattacaactacggcggatgaattcggcatcaaactgaaatttttccat
ggccgcggcggagcccttggccgtgggggcatgccgctgaaccgcagtattctggctcaa
ccagcttcgacgattggcggcggcattaagattacagagcagggcgaggtcatctcctca
cggtactcgatgcagggaatcgcctaccgcagcttggaacaggcaacctccgcgctgatc
acggcagcgattaatgccagatcgccgcaggctgatctgtacgaccctaaatgggaagag
attgtggcccggatttctgaagtatcactgagcaaatatcaggacctgatcttccgtgat
ccggatttcctgaactactttaaggaatcgacgccgcttcctgaggttggagagcttaat
attgggtcgcgtccttccaaacgaaagaatagcgaccgctttgaagacctgcgtgcgatc
ccttgggtttttgcctggacacagagccgttacctgcttcctgcatggtacgctgccgga
acggggctgcagagcttctacgacgacaaggaagagaacctgaagatcatgcagcatatg
tatgaaaaattttcgttcttcactacgttaattgatactctgcaaatggcgattgccaag
gcggatctgattattgccaaggaatacgccggcatgggcaaaaatgaggaggcgcgtcag
cgcatcttcggacagatcgaagcggaattcaagctgacctccgagctgattctcaaaatc
accggacagcaggatattctggataacgttcctgtcatccaggaatccattcgcttgcgg
aatccttacgttgatccgctcagctacctgcaggtgcagctcttgtctgagctgagagcc
cttcgtgaagccgagggcgatgacgccgagcttctgcgcgaggtgctgcttaccatcaac
ggcattgccgccggactgcggaataccggctga

DBGET integrated database retrieval system