Providencia rustigianii: NCTC6933_00203 Help Entry NCTC6933_00203    CDS       T06047                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism prj  Providencia rustigianii Pathway prj01100   Metabolic pathways prj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:prj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC6933_00203   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC6933_00203 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  VEB63082 LinkDB All DBs Position 1:208923..209183 Genome browser AA seq 86 aa AA seqDB search MTTQHATAQQWLENHIQQMRTYSGITKQYSMDAELIADVHIDSLELLELIAAVEIYTEQP LRDEVWMKWRRLQDIVDYLAKTVVIN NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaccacacaacatgcgactgcgcagcaatggctagaaaatcatattcagcaaatgcgg acttattcagggattacgaaacaatattcaatggatgctgagcttatcgcggatgtacac attgattctttagagctgttagagttgattgccgcggttgaaatttatacggagcagcca ttgcgtgatgaagtgtggatgaaatggcgacgtttacaagatattgtggattatctcgct aaaaccgtggtcattaactaa

DBGET integrated database retrieval system