KEGG   Providencia rustigianii: NCTC6933_02700Help
Entry
NCTC6933_02700    CDS       T06047                                 

Definition
(GenBank) chromosome segregation protein SMC
Organism
prj  Providencia rustigianii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C TSC22 ATG16
Motif
Other DBs
NCBI-ProteinID: VEB71815
LinkDB All DBs
Position
1:complement(2668905..2671403)
Genome map
AA seq 832 aa AA seqDB search
MADAKAQLQAQQTQAEQKLASLGESSDKQVNTLTAQNQQLTAQLAEKVKQHEAAQTTLAK
QNAELAQQQTQLAQQKSGLETDLTAAQKQLADAKAQLQAQQTQAEQKLASLGESSDKQVN
TLTAQNQQLTAQLAEKVKQHEAAQTTLAKQNAELAQQQTQLAQQKSGLETDLTAAQKQLA
DAKAQLQAQQTQAEQKLASLGQTSDKQVNTLTAQNQQLTAQLAEKVKQHEAAQTTLAKQN
AELAQQQTQLAQQKSGLETDLTAAQKQLADAKAQLQAQQTQAEQKLASLGQTSDKQVNTL
TAQNQQLTAQLAEKVKQHEAEQTTLAKQNAELAQQQTQLAQQKSGLETDLTAAQKQLVDA
KAQLQAQQTQAEQKLASLGQTSDKQVKTLTDKNQQLALQLASQVAQLSEKSNLETELAIA
KKQQVEQKNNQERLTKQLTDSQNQQDLLQTQLAANEKSYIDTQSQLKQANSQVQKLQKDL
EKQTALVGKASDKQIKDLTSDLSKQISLLEQREAELAKLGADKQGIQDALTAQLSDKKKL
ESQNSKLVAQAKDQEKQISQLETDLANRNKQQSDIEQRLLDANKQLNELKLEAQKFTAEN
TGKQNQELDKLKKQLDDKVLADTKVQKELTKAKESLKKAEDELVSLKSFSTDDGLKSQIR
DLNQRVMQLRKENDSLKSAQTHQAQSSGKTPSIIKIPAKDTNSVAQENAKRNQKIIQDIN
QQKYSKLDSHTYYKVLQKGAPISNVADKQITIIMREQLTDGKVTVMHTEQNPMVLAYNQL
PPPLNMFVDKIGVGGMVKVYIEPEGGYGVDGVPGTIPPNSMSIIDFKVISAK
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
ttggcggacgcgaaggcacagttacaggcacaacaaacgcaagctgagcagaaactggcg
tcattgggtgaatccagcgacaaacaagtgaatacgctgaccgcgcagaatcagcaactc
acagcgcaattggcggaaaaagtgaagcagcatgaggcggcgcaaacgacgctggcgaag
caaaatgccgaattagcgcagcagcaaacgcagctagcccagcaaaaaagtggactggaa
accgatttaaccgcggctcagaagcaattggcggacgcgaaggcacagttacaggcacaa
caaacgcaagccgagcaaaaattggcgtcattgggtgaatccagcgacaaacaagtgaat
acgctgaccgcacagaatcagcaactgacagcgcaattggcggaaaaggtgaagcagcat
gaggcggcgcaaacgacgctggcgaagcaaaatgccgaattagcgcagcagcaaacgcag
ctagcccagcaaaaaagtgggctggaaaccgatttaaccgcggctcagaagcaattggcg
gacgcgaaagcacaattacaagcacaacaaacgcaagccgagcaaaaattggcgtcactg
ggtcaaaccagcgacaaacaagtgaatacgctgaccgcacagaatcagcaactcacagcg
caattggcggaaaaggtgaagcagcatgaggcggcgcaaacgacgctggcgaagcaaaat
gccgaattagcgcagcagcaaacgcagctagcccagcaaaaaagtgggctggaaaccgat
ttaaccgcggctcagaagcaattggcggacgcgaaagcacaattacaagcacaacaaacg
caagccgagcaaaaattggcgtcactgggtcaaaccagcgacaaacaagtgaatacgctg
accgcgcagaatcagcaactcacagcgcaattggcggaaaaggtgaagcagcatgaggcg
gagcaaacgacgctggcgaagcaaaatgccgaattagcacagcagcaaacgcagcttgcc
caacaaaaaagtggactggaaaccgatttaaccgcggctcagaagcaattggtggacgcg
aaggcacaattacaggcacaacaaacgcaagccgagcagaaactggcgtcactgggtcaa
accagcgacaaacaagttaaaacattgacggataaaaaccagcaattagcgttacaactc
gctagtcaggttgctcaattatcggaaaaaagtaacttagagactgaattagctattgct
aaaaaacagcaagtagagcagaaaaataatcaagaaaggctcactaaacagttaactgat
agccaaaaccagcaagatttattgcaaacgcaattagcggcgaatgagaaaagttatata
gatactcaatctcaattgaagcaagcgaattctcaagtacaaaaattacaaaaagacttg
gaaaaacaaacggcattggttgggaaagctagtgataagcaaattaaagatttaacgagt
gacctaagtaaacaaatttctttattggaacaaagagaagctgaattagctaaacttggt
gcagataagcagggtattcaggacgctttaactgctcagttatcagataagaaaaaactc
gaatctcaaaattcgaagttagttgcgcaagctaaagatcaagaaaaacaaatatctcaa
cttgagactgatcttgctaatcgtaataaacaacaatcagatattgaacagagattatta
gacgcaaataaacagcttaatgaattaaagctagaagcacaaaaatttacggctgaaaat
acaggtaaacagaatcaagaattagataagcttaaaaagcagctggatgacaaggtgtta
gccgatactaaggttcagaaagaactaacaaaggcaaaagaaagtttgaagaaagctgaa
gatgaattagtttcattaaaatcattctctaccgatgatgggcttaaatctcagattaga
gatttaaatcagcgagttatgcagttaaggaaggaaaatgactcgctcaaatcggctcag
acacatcaggcacagtcatcaggtaaaacgccaagcatcattaagatccctgcgaaagat
acaaattcggttgctcaagagaatgcaaaacgtaatcaaaaaataatacaggacattaac
cagcagaaatacagtaaattggatagtcatacttattataaagtcttacaaaaaggtgca
ccgatttctaatgtagcagataaacaaatcacaattatcatgcgagagcagttgacggat
ggtaaggtgactgtcatgcatacagaacaaaatccaatggttttagcttataatcagtta
ccaccgccattaaatatgtttgttgataaaattggtgttggcggtatggtgaaagtttat
attgaacctgaaggtggttatggggttgatggtgttcctggcacaattccaccaaactca
atgtccataattgattttaaagttataagcgcaaaataa

DBGET integrated database retrieval system