KEGG   Propionibacterium sp. oral taxon 193: BCB70_06670
Entry
BCB70_06670       CDS       T04515                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
prl  Propionibacterium sp. oral taxon 193
Pathway
prl00620  Pyruvate metabolism
prl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCB70_06670
Enzymes [BR:prl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     BCB70_06670
SSDB
Other DBs
NCBI-ProteinID: AOH45638
LinkDB
Position
complement(1414577..1417957)
AA seq 1126 aa
MATQAHTDSVNLRLALNGLPLPTAARASDIDVVAPVLARQRELRREIPELLCPADRRIQA
FIDRYLGENSPVRPRLPETTLTLDEPGLARALSLPVDSDEFTSDLVASYRVANGVLHNPR
NDRRTTAGVFHVTEGGLAIPDDKKAVPIDVFARLLDLAFQAPPEHTLLPYTSTQPIERQA
YTWVSLLLRPLVVPKVSNFVSERRMEVRFFAPGGLVSNLDFVEGIFGNAGDPLLPSNDSA
LAPTGWTGHSGCVILAPHLNLARKVDLGLPHIDQATERQRRDGMCWSEESELYNEGKPFK
LCARDESGVILTIVADNYFGYCKKEVKTQISYSANLFGLAEEEHSGGARAYTSHNQGQEF
ATPTCERTVSDVVAANPDRFEMLDDGHARVLGIDDVVLVPGGAKFSLCDGTVSWEDNDHS
IRMRADTEYVSPDGYRMRMIHNDADDQWYLEGTYGDSTTLHKCCTVSGGGKSEISKAISD
TFLWGNAYAPDFDADMDAADDILHRDFSTRFADPKLNGVDHRPVLSTERSVGSVIKLLTP
SSDFSDWYNDWIESIPAFRKELVFTIKRYYKPEWGDDWRSHFSVAPTNGRHGNMVRLDGQ
KVLVSMARVGFEPDGSWRLFTLRHDYAPAVKVQTEDDMTASIVTSPGMVTGPKGLSRKII
ANCEALLFQRPDDAIYRGYDTQTESDMSGHDLFISNYQPLTRDEVKQMRDDVVAFSKFTR
PMRTFLSDFADSDPSEMPDFAVSSADPRLIDGARSRNPRYLQVRPDIANPRETAIADLSS
HLYHGLRVNKPLSLPVDVVAAGRRNNPPEDKIPALCAYNPLHYMELPELFMEFISSMTGK
SPSTTGAGSEGALTKAPFNALPAVFDLNSSFLSFVLSGYDGWLSSAGFIGPKVEVAHDIS
LLVPEIFCRMSPQERDAKTLIEGGYLEKLEDYDKDGELILASRLGYRMTEKFMRTYFGRI
FLHPDTVFTPEMLRPELQDAEIFADSVRTISATHARVAKAYFDDGTISLAVPPIRALLEI
MASGTSSEGWTLNDPQLRETFTRESVLTSDWYAERLDAKQAEDVRRSEQGIAHLEQFMAD
PRNATACEEIDVQARLDQVRWFHDRAVSAEYRQQLVGTLGRQVNFR
NT seq 3381 nt   +upstreamnt  +downstreamnt
atggccacccaagctcatactgactccgtgaatctcagactggcgctcaacggtctgccc
ctgccaaccgctgcgcgcgcttctgacattgacgtcgttgccccggtactagctcgacaa
cgagagctgcgtcgggagattcccgagctcctctgccccgccgaccgtcgtatccaggca
ttcatcgaccgctacctaggcgagaactcccctgtccgtccccgcctacccgaaaccact
ttgaccctcgacgaacccggccttgcacgggctctttcgctacccgttgacagcgatgag
ttcacctccgacctcgtggccagctaccgggtagctaacggcgtcctacacaacccccga
aatgaccggcgcaccaccgccggggttttccacgtcaccgaggggggcttggctatcccc
gacgataagaaagccgtcccaatcgacgtcttcgctcgtcttctcgaccttgccttccag
gcaccaccggaacacactctgctgccgtacacctccactcagccgattgagcgtcaggcc
tacacgtgggtatctctactgctgcgccccctcgtggtgccaaaagtgtcaaacttcgtc
tccgagcgtcgcatggaggtccgcttcttcgctcccggcggtctggtctccaatcttgat
ttcgtcgaagggattttcggcaacgccggtgacccgctgctgcccagcaatgactctgct
ctagcccccaccggatggactgggcacagtggctgcgttattttagccccgcatctcaac
ctcgcccgcaaggtcgaccttggcctgcctcacatcgaccaggctactgagcgccagcgt
cgcgacggaatgtgctggtctgaagagtccgaactctacaacgagggcaaacctttcaag
ctatgtgcccgtgacgagtctggggtcatcctcaccatcgtcgccgacaattattttggg
tactgcaagaaggaggtcaagactcaaatctcctactccgcgaatttgttcggtttggcc
gaggaggagcattccggcggcgcccgcgcctacacctcccacaaccaaggccaggaattt
gccactccgacctgcgagcggacggtttccgacgtcgtcgcagcaaatccggatcgtttt
gagatgctcgacgacggccatgcccgggtacttggtatcgacgacgtcgtcctcgtaccg
ggcggagccaagttcagcctgtgcgacggtacagtcagctgggaggacaacgatcactcc
atccgcatgcgcgccgacactgagtacgtttccccggacggctaccggatgcgcatgatt
cacaacgatgccgacgaccagtggtacctcgagggaacctatggtgactcgacgaccctg
cacaagtgttgcacggtttccggtggcgggaaatccgagatctccaaggccatctcggac
accttcctgtggggcaatgcctacgccccggacttcgacgcggacatggacgccgccgat
gacatcttgcatcgagatttctctacgcgattcgccgatccgaagctcaatggtgtcgat
caccgcccggttctctcgacggaacgttcggtaggctcggtcatcaagttactcaccccg
tcctcggacttcagcgactggtacaacgactggatcgaatcaatcccggcattccgcaaa
gagttagtcttcaccatcaagcgctactacaagccggaatggggtgacgattggcgctcc
cacttcagcgtcgctcccactaacggtcgtcacggcaacatggtccgtcttgacggccag
aaggtcctggtgagcatggcgcgcgtgggattcgaacccgatggctcatggcgattgttc
accctgcgtcacgactacgccccggctgtcaaggtgcagaccgaggatgacatgacggca
tcgatcgtgacgtctccgggcatggttaccggccccaagggtctgtcgcgcaaaatcatc
gccaactgcgaggcattgctcttccagcgccccgacgatgccatttaccgcggatatgac
acccagaccgagtccgacatgagcgggcatgatttgttcatctcgaattaccagccgctg
acccgcgacgaagtcaagcagatgcgggacgacgtggtggccttctcgaaattcacccgg
ccgatgcgcaccttcctatccgacttcgccgattccgatccatcggaaatgccggacttc
gccgtctccagcgccgatcctcgtctcatcgacggggcacgttcgcgcaatccgcgatat
ctgcaggtacgtccagacatcgccaacccgcgcgaaaccgcgatcgccgatctgtcaagt
cacctataccatgggctgcgagtcaacaagccactgtcgctcccggttgatgtcgtggct
gccgggcgtcggaataacccgcctgaggacaagattccagccttgtgtgcgtacaacccg
ctgcactatatggagttgccagaacttttcatggagttcatctcgtcgatgaccggcaag
agcccttcgacgacgggcgccggttcagagggagccctgacaaaggcgccgttcaacgcc
ctaccggcagtcttcgaccttaactcgtcctttctgtccttcgtgctgtcagggtacgac
ggttggttgtcctcggccgggttcattggcccgaaggttgaggtggcacacgatatttcc
ctgcttgtcccggagattttctgccggatgtcgccacaagaaagggatgccaagaccctc
attgaagggggctatctcgagaagctggaggattacgacaaggacggcgaactcattctc
gcctcgcgtctgggctaccgcatgaccgagaagttcatgcgcacctacttcgggcgtatc
ttcctgcaccctgacactgtgttcacccctgagatgctgcgtccggagctacaggacgcc
gagattttcgccgattcggtgcgcaccatctcagcgacccacgctcgggtcgcgaaggcc
tatttcgacgatggaacgatttccttggctgtgccgccgattcgggctctcctggagatc
atggccagcgggacctcctcggaaggctggactctcaatgatccccagctgcgtgaaacg
ttcaccagagagtcggtactaacctccgactggtacgccgagcgcctcgacgctaagcag
gctgaagacgtccgccgctctgaacagggcatcgcccaccttgagcagttcatggccgac
ccgcgcaacgcgactgcctgcgaagagatcgacgtccaagcccgcctggatcaagttcgc
tggttccatgaccgcgctgtgtcggctgaataccgtcagcagttggtggggaccctcggt
cgccaggtcaacttccgctga

DBGET integrated database retrieval system