KEGG   Propionibacterium sp. oral taxon 193: BCB70_06700
Entry
BCB70_06700       CDS       T04515                                 

Definition
(GenBank) glycosyl hydrolase family 31
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
prl  Propionibacterium sp. oral taxon 193
Pathway
prl00052  Galactose metabolism
prl00500  Starch and sucrose metabolism
prl01100  Metabolic pathways
prl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:prl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BCB70_06700
   00500 Starch and sucrose metabolism
    BCB70_06700
Enzymes [BR:prl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     BCB70_06700
SSDB
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2
Other DBs
NCBI-ProteinID: AOH45644
LinkDB
Position
complement(1420089..1421081)
AA seq 330 aa
MKCLDALGYDAGSTDPLYKHVPFLMTRTTNGAFGIFYDNLSASRFNLGAEVDNYHRPFTS
WQADHGDIDFWVMTAERVTSLTPQILRLTGDPAFLPRWALGYSGSTMHYTDAPDASHQLL
KFIDLLREHAIPCDSFQLSSGYTTIGSRRYVFTWNRDKFPQPTETTGHFSETGLHLAANI
KPALLTTHPYYRDAAQAGIFVTTSRTGKPATSMFWGGHGSNVDFTNPLGVQWWKDNVRHQ
LIDMGIESTWNDNNEYELWSEDATCDGFGHPVELDLIRPVQALLMNRASFEAQREAAPAE
RPFLFPGLGRWVYSVMSRPGVVTIPPPGAP
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaagtgcctggacgccctgggatacgacgctggtagcaccgacccgctatacaaacat
gtgcccttcctcatgacccgtacaaccaacggtgcttttgggatcttctacgacaacctc
tcggcatcacggttcaatctgggagcagaagtcgacaactaccaccgccctttcacctcg
tggcaggccgaccacggcgacatcgacttttgggtcatgactgccgagcgcgtcactagt
ctcaccccgcagatcttgcgtcttaccggcgacccggcttttctaccgcgctgggccctg
gggtactcgggctcaacgatgcactacaccgatgcccctgacgcctcccaccagttactg
aaattcatcgacctgctgcgcgagcacgccatcccgtgcgactccttccaactttcgtcc
ggctacaccaccatcggttcacgtcgctacgtctttacctggaaccgtgacaaatttccc
cagcccaccgagaccacggggcacttcagtgagaccggcctccacctggcggcaaatatc
aaacccgctctactaacgacgcacccctattaccgcgatgcggcgcaggcggggattttt
gtcaccacctcccggactgggaaaccggcaacgtcgatgttctggggcggtcatggcagc
aacgtcgactttaccaacccgctcggggtgcagtggtggaaagacaacgtccgccaccaa
ctcatcgacatgggaatcgaatccacctggaacgacaacaacgagtacgaattgtggtca
gaggacgccacgtgtgacggttttggtcaccccgtcgagctggacctcattcgcccggtg
caggcccttctcatgaaccgcgcgtcttttgaagcccaacgcgaggctgcccctgctgag
cgtcccttcttatttcccggtctgggccgttgggtctacagcgttatgtccagacctgga
gtggtgacaattccacctcctggcgcaccctga

DBGET integrated database retrieval system