KEGG   Propionibacterium sp. oral taxon 193: BCB70_07020Help
Entry
BCB70_07020       CDS       T04515                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
prl  Propionibacterium sp. oral taxon 193
Pathway
prl00010  Glycolysis / Gluconeogenesis
prl00030  Pentose phosphate pathway
prl00051  Fructose and mannose metabolism
prl00052  Galactose metabolism
prl00680  Methane metabolism
prl01100  Metabolic pathways
prl01110  Biosynthesis of secondary metabolites
prl01120  Microbial metabolism in diverse environments
prl01130  Biosynthesis of antibiotics
prl01200  Carbon metabolism
prl01230  Biosynthesis of amino acids
prl03018  RNA degradation
Module
prl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:prl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCB70_07020
   00030 Pentose phosphate pathway
    BCB70_07020
   00051 Fructose and mannose metabolism
    BCB70_07020
   00052 Galactose metabolism
    BCB70_07020
  09102 Energy metabolism
   00680 Methane metabolism
    BCB70_07020
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BCB70_07020
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:prl01009]
    BCB70_07020
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:prl03019]
    BCB70_07020
Enzymes [BR:prl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BCB70_07020
Protein phosphatases and associated proteins [BR:prl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BCB70_07020
Messenger RNA biogenesis [BR:prl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BCB70_07020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AOH45697
LinkDB All DBs
Position
complement(1499877..1502141)
Genome map
AA seq 754 aa AA seqDB search
MRVNDEIRLTPTLPDGHGLRIGILTSGGDAQGMNAAVRAVVRSALSVGAEVYAIYEGYQG
MIDGGDGIRKFRWDDVGSIFNRGGTVIGTFRCKEMRERPGRLKAVRNLLEHGIDRLVVIG
GDGSLTGLDVLRTEWTGLLAELVDTGQVSAEVAREHPTLMIAGLVGSIDNDLVGSDMTIG
ADTALHRIVDAIDDLTSTAASHQRSFVVEVMGRHCGYLALMAAVAGGADYVLIPERPPEN
GWEDRMCAELKRGRQAGRRDSIVIVAEGATDRAGNRISSEYVRQVLEDKLGEDARVTILG
HVQRGGRPSAYDRWASTWLGHHAVHEVLSTTPEAEGRVIGTGTNRIHRLPLVKAIADTKS
VPGLIAEGRYNEAMRMRGRSFVEMDAIFTELSEPARTTSDTAGDADRKRIAIMHAGGPAP
GMNTAARAAVRLAISRGHTVVGIHNGFVGLAAGDMSELAWSDVEGWAGEGGAELGTRREI
PNTRDLYAVSRALEDNHIDALLVIGGYSAYEGIHTMTTERDRYPAFRIPTVCIPASIDNN
LPGSELSIGADTALNVIVEAMDKVKESGIASRRCFVVETMGRDCGYLALMSGIAAGAERI
YTNEDGISLDDLVNDVHWLRESFAHGRRLFLAVRNENASHNYTTDFIARLLEEESHGMYD
VRQVVLGHMQQGGSPSPFDRLLANRLTYRALNLIDDELAARQDGSWFIGVNESGMRPSPM
ETMLSLVDAAHRRPREQWWLQLRTIARTVSDEVR
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgttaatgacgagataaggctcacccccactctccccgacggtcacggtctgcgg
atcggcatcctgaccagcggaggcgacgctcaaggcatgaacgccgccgtgcgagccgtg
gtgcgctctgcactaagtgtgggagccgaggtctatgcgatctacgagggctaccaggga
atgatcgatggcggcgacggcatccggaaattcaggtgggacgacgtcggttcgatcttc
aaccgtggtggcaccgtcatcggaactttccgctgcaaagaaatgcgcgaacgcccggga
cgcctgaaggctgtcagaaatctcctcgaacacgggatcgatcgtctcgtcgtcatcggc
ggcgacggttcgcttaccggcctagatgtgctgcgcaccgagtggaccggcctgctcgct
gaactcgtcgacaccggccaggtgagcgccgaggtagcccgcgagcatcccaccctcatg
atcgccggactcgtcgggtccatcgacaacgacctcgtcggatccgatatgactatcggc
gccgacactgctctgcaccgcattgtcgatgccatcgacgacctcacctccaccgcggcc
agccaccagcgatccttcgtcgtcgaggtgatgggccgccattgcggctacctcgccctc
atggcggccgtcgccggcggcgctgactacgtccttatcccggagcggccgcccgaaaat
ggctgggaggaccgcatgtgcgccgaactcaagcgtggccgtcaggcgggtcgacgcgac
tcgatcgtcatcgtcgcggagggcgccactgatcgcgccggcaaccggatttcgtcggaa
tacgtccgtcaggtgctcgaggacaaactgggtgaggacgcccgtgtaaccatcctgggt
catgtccagcgtggcggacgaccgtcggcctatgaccgctgggcatcgacctggctgggt
catcacgcggttcacgaggtgctctcgaccactccggaggccgagggacgcgttatcggt
accggaactaaccgcattcatcgcctccctttggtcaaggccatcgctgacacgaagtcg
gtgcccggtctcatcgcggagggtcgatacaacgaggccatgcggatgaggggacgttcc
ttcgtcgagatggacgccatcttcaccgaactcagcgagccagctcgcaccacctccgac
accgctggcgacgccgaccgcaaacgcatcgcgattatgcacgccggtggtccggctccg
ggcatgaatactgctgctcgtgcagcagtccgactggcgatttcccgcggtcataccgtt
gtggggatccataacggattcgtcgggctggcagccggggacatgtcggaattggcttgg
agcgacgtcgagggttgggccggggaaggcggcgccgagctgggcacccgccgggagatc
cccaacactcgcgacctgtacgctgtcagccgcgccttggaggacaatcacatcgacgcg
ctgctcgtcatcggcggctactcggcctacgaaggtatccacaccatgacgactgagcgg
gaccgatacccggccttccgtattccaacggtgtgcatcccagcctcgatcgacaacaac
cttcccggttcggagctatccatcggcgccgacaccgccctcaacgtcatcgtcgaagcg
atggacaaggtcaaggagtcgggtatcgcatccaggcgctgcttcgtcgtcgagacaatg
ggccgtgactgcggttacctcgcactgatgtcgggtatcgctgctggtgctgagcggatt
tacaccaacgaagacggtatctctctggatgacctggtcaacgacgttcactggttgcgg
gagtctttcgcccacggacgccggctcttccttgccgtacgtaatgaaaatgcgtcgcac
aattacaccaccgacttcatcgcgcggctgctggaggaggagtcccacggcatgtatgac
gtgcgccaggtggtgctaggacatatgcaacagggcggctcaccttcacccttcgaccgc
ttgctcgccaatcgactcacctaccgtgctcttaatcttattgacgacgagttggcggcg
cgtcaggacggttcgtggtttattggcgtcaacgagtcaggaatgcggcctagcccgatg
gagacgatgctttccctcgttgacgccgctcatcgtcgtccccgtgagcagtggtggctg
caactgaggaccattgcccgcacggtctcggacgaggtgaggtga

DBGET integrated database retrieval system