KEGG   Propionibacterium sp. oral taxon 193: BCB70_08470Help
Entry
BCB70_08470       CDS       T04515                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
prl  Propionibacterium sp. oral taxon 193
Brite
KEGG Orthology (KO) [BR:prl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BCB70_08470
Enzymes [BR:prl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BCB70_08470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA HI0933_like Thioredoxin_3 Thi4 FAD_oxidored NAD_binding_8 FAD_binding_3 DAO AlaDh_PNT_C K_oxygenase Glutaredoxin FMO-like NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AOH45935
LinkDB All DBs
Position
complement(1798656..1800230)
Genome map
AA seq 524 aa AA seqDB search
MLDNALTTQLKSYLEMVREPIILVPSPYQGDDATKSSKSTQMDELLSEITALSDKVSVGE
PVDNERTPSFAITRPGSPIDIHFAGLPMGHEFTSLVLALLQVGGHPVKEEQSLIDAVRAV
KGEHHFVTYMSLTCQNCPTVVQALNAMAVLNPNIHHTAVEGGTYTDEVEAKGIASVPAIY
LDSEDWGSGRMDMADILERLDTDAAQGAKEDLSQRDPYDVLVVGAGPAGAAAAVYAARKG
IRTAIVGSRIGGQVLDTEAIDNLISVPHTTGPRLADALRSHVNDYDIDVIERQTASALET
TDGMATVHLTDGNLRARSVILATGARWRNLGVPGEEEYRTKGVTNCPHCDGPLFKGKKVA
VVGGGNSGIEAAIDLAGVVDHVTVVEFLDVLKADDVLLRTLSSLPNVDVITSARTTQILG
DGSKVTGLEYEDRTSGEVKSIELAGVFVQIGLLPNTEWLEGTLERSMRGEIVIDERGTTS
IPGVFAAGDCTTQPYKQIIISMGAGATAALGAFDHLIRQNPTQN
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgcttgataatgccctgaccacccagctcaagtcctacctcgagatggtgcgcgagccg
atcatcctggtgccttccccgtaccagggtgacgacgccaccaagtcgtcgaagtcaacc
cagatggacgagctgctgtcggagatcaccgccttgtctgacaaagtgagcgtcggtgag
cccgtcgacaatgagcgcaccccgtcctttgccatcactcgccccggaagccccatcgac
atccatttcgccggtctgccgatgggccacgagttcacctccctcgtgctggccctgctg
caggtgggtggtcaccctgtcaaggaggagcagtccctcatcgacgccgtgcgcgcagtc
aaaggggagcaccatttcgtcacctacatgtcgctgacctgccagaactgcccgacggta
gtgcaggccctcaacgcgatggccgttctcaaccccaatattcatcacaccgccgttgag
ggtggcacctacaccgatgaggtggaggccaaaggaatcgcctcagtgccggccatctac
ctggatagcgaggactggggctccggacgcatggacatggccgacatccttgagcgtctc
gacaccgacgctgcccagggagccaaggaggatctgtcgcagcgcgacccctacgacgta
ctcgtggtcggggctggtcctgctggtgccgccgccgcggtgtacgcggctcgtaaaggt
atccgcaccgccatagtcgggtctcggatcggcggtcaggtgctcgataccgaggccatc
gacaaccttatctcggtgccccacaccaccggcccgcgtctggccgacgccctacgcagc
cacgtcaatgactacgacattgacgtcattgagcgtcagaccgccagtgctctggaaacc
accgacggcatggccaccgtgcatctaaccgatggcaacctgcgggcgcgctcggtcatt
ctggccaccggtgcacgctggcgcaaccttggcgtgcccggcgaggaggagtaccgcact
aagggcgtaaccaactgcccgcactgcgacggcccgctgttcaagggtaagaaggtggcc
gtcgtcgggggcggaaactccggcattgaggccgctatcgaccttgccggtgtcgttgac
cacgtcaccgtcgtggagttcctcgacgtcctcaaggctgacgacgtcctgttgcgcact
ttaagctcgctgccgaatgttgacgtcatcacttcagcccgcaccacccagatccttggc
gacgggtccaaggtgaccggcctggaatacgaggaccgcaccagtggtgaagtgaagagc
atcgagctagcaggtgtcttcgtccaaatcggtctgctgcccaacaccgagtggctcgaa
ggtaccctagagcgcagcatgcggggagaaatcgtcattgacgagcgcggcaccacttca
attcccggtgtcttcgccgccggtgactgcaccactcagccgtacaagcagatcattatc
tccatgggggctggcgccaccgcggctctgggggccttcgaccacctcatccgtcagaat
ccaacgcagaactga

DBGET integrated database retrieval system