KEGG   Prochlorococcus sp. MIT 0801: EW15_0065Help
Entry
EW15_0065         CDS       T03316                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit B Glutamyl-tRNA(Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
prm  Prochlorococcus sp. MIT 0801
Pathway
prm00970  Aminoacyl-tRNA biosynthesis
prm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EW15_0065
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:prm03029]
    EW15_0065
Enzymes [BR:prm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     EW15_0065
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     EW15_0065
Mitochondrial biogenesis [BR:prm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    EW15_0065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AIQ96157
UniProt: A0A089P903
LinkDB All DBs
Position
66005..67429
Genome map
AA seq 474 aa AA seqDB search
MQLGTNSKIFTSASTNFGDDPNTHIDPVVCGLPGTLPVLNKKVLEYAVKAAMALNLNIAS
HSKFDRKQYFYPDLPKNYQISQFDEPIAEDGWIEVEVAEKGKETYVKKIGIERLHMEEDA
GKLVHAGSDQLSGSTHSLVDYNRAGVALAEIVSKPDLRTGREAAEYAAEIRRIMRYLGVS
DGNMQEGSLRCDVNISVRPTVNDPFGTKVEIKNMNSFSAIQKACEYEIKRQIKAYESGEE
VKQETRLWDEGKQLTKSMRSKEGSSDYRYFPDPDLGPIEVSNDLKEKWRSELPELPAAKR
NRYSAELGLSIYDARVLTDESSMAKYFEKVVNEGGAAKSSANWITGDIAAYIKSNKLSFD
QLTFKPNELAEMLKMIDSGEISGKIAKDILPELLNNGGSPKQLVQERGLGMIGDPKVIEE
IIDQLIVRHPNEVESFRAGKKKLLGFFVGQLMKETKGKADPKLANQILNKKLQG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
gtgcagttggggactaatagcaaaatatttaccagcgcatcaacaaattttggtgacgat
ccaaatactcatatcgacccagttgtttgcggattaccaggcactttaccagttttaaat
aagaaggttttggaatatgcagtaaaagcagcaatggctttgaatctaaatattgcttct
catagcaaatttgatagaaagcaatatttttatccagacctaccaaaaaactatcaaata
tctcagtttgatgaacctattgcagaagatggttggatagaggtagaagtggctgaaaaa
ggcaaagaaacttatgtcaaaaaaataggtattgaaagactacatatggaggaggatgcg
ggaaaacttgttcacgcaggtagtgatcaattgtcaggttccacacattctttggttgat
tacaatagggcaggtgtggcactagctgaaatagttagtaaacctgatttaagaacaggt
agagaggctgcggaatatgcagctgagattagaagaataatgcgttatttgggagtatct
gatgggaacatgcaggaaggttctttgcgttgtgatgtgaatatttcagtcagaccgact
gttaacgacccatttggcacaaaagtagaaataaaaaatatgaattcattttcggctatt
cagaaagcttgtgaatatgaaattaaacggcaaataaaagcttatgaatccggagaagaa
gtaaaacaagaaacgaggttatgggatgaaggtaagcaactgactaaaagtatgagatcc
aaagaaggcagtagcgattatcgttattttcctgatcctgatttaggtccgatagaagtc
agtaatgatttaaaagaaaaatggcgttcagaattaccagaattgccagctgcaaaaaga
aatagatattcagcagagctcggtctttctatttatgatgcacgagttttgactgatgaa
tcttcaatggctaaatactttgagaaagttgttaatgaaggtggggcagcaaaatcttca
gcaaattggataacaggagatatagcagcctatataaagtctaataaattatcatttgat
caattaacctttaagccaaatgaattagcagaaatgttaaaaatgattgattctggagaa
ataagtggaaaaatcgcgaaagacattttacctgaactattaaataacggtggttcccca
aagcaattagtccaagaacgtggtttaggtatgattggtgatccaaaagtgattgaagaa
attattgatcaattgatcgttaggcatcctaatgaggttgaatctttcagggctgggaag
aagaaacttttaggtttttttgttggtcaattaatgaaggaaacaaaagggaaagcggat
ccaaaactcgcaaatcaaatattaaataaaaaattacaaggttag

DBGET integrated database retrieval system