KEGG   Prochlorococcus sp. MIT 0801: EW15_0470
Entry
EW15_0470         CDS       T03316                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
prm  Prochlorococcus sp. MIT 0801
Pathway
prm00010  Glycolysis / Gluconeogenesis
prm00020  Citrate cycle (TCA cycle)
prm00620  Pyruvate metabolism
prm01100  Metabolic pathways
prm01110  Biosynthesis of secondary metabolites
prm01120  Microbial metabolism in diverse environments
prm01200  Carbon metabolism
Module
prm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:prm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EW15_0470
   00020 Citrate cycle (TCA cycle)
    EW15_0470
   00620 Pyruvate metabolism
    EW15_0470
Enzymes [BR:prm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EW15_0470
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Other DBs
NCBI-ProteinID: AIQ96562
UniProt: A0A089PA29
LinkDB
Position
412525..413895
AA seq 456 aa
MATHDIFMPALSSTMTEGKIVEWLKKPGDKVERGESVLVVESDKADMDVESFQDGFLASI
VMPAGSSAPVGETIGLIVETADEIAAAQANAPSPSTQSSSKEKESSSPQVQEKQASVDSP
KATVVTKASPAPLVSESSVNQDQFLNDGRIVASPRAKKLASQMGVDLATVRGSGPHGRIQ
AEDVQSAKGQPISVPWIAESNAPAKIVSDVPRIEKKSVDSGKPPAPGKSFGSRGETIAFN
TLQQAVNRNMEESLNTPCFRVGYSILTDELDDLYKQVKPNGVTMTALLAKAVGLTLARHP
QVNAAFSSEGIAYPSQINVAVAVAMEDGGLITPVLQNADKTSLADLSLQWADLVKRARNK
QLEPQEYSSGTFTLSNLGMFGVDRFDAILPPGTGAILAVGASLSKVVASKDGSISIKKQM
QVNLTADHRVIYGADGALFLKDLAYLIEKNPYSLSS
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggccactcatgacatctttatgcctgctttaagttcaacgatgactgagggcaaaata
gttgagtggctaaaaaaacctggagataaagttgaaagaggtgagtcagttttagttgtt
gagtcagataaagctgatatggatgttgagtctttccaagatggctttcttgcttcgatt
gtgatgcctgcaggcagctctgcacctgttggagagacaatcggattgatcgttgagaca
gcagatgagatcgctgcggctcaagcaaatgcaccttctccttccactcaatcaagtagt
aaagaaaaagagagttcatcgcctcaagttcaagaaaaacaagcctctgttgactctccc
aaagcaacagtagttacaaaggcatcgcctgcacctcttgtttcagaatcctctgtaaat
caggatcagtttttaaatgatggtcgaatagtcgcttccccaagagctaaaaaacttgct
tctcaaatgggagtggatttggcaactgttaggggctcaggacctcatggacgaatacaa
gctgaggatgttcaaagtgcaaaagggcaacccataagcgttccttggatcgcagaaagt
aatgctccagcgaaaatcgtttctgacgtgcctcgcatagaaaaaaaatctgttgactct
ggtaagccacctgctccagggaaaagttttggatctagaggagaaacaattgcattcaat
actcttcaacaagcggtaaatcggaacatggaggaaagtttaaatactccttgtttcaga
gtcggatattcaattcttactgatgaattggatgatctttataaacaagttaaacctaat
ggagtaactatgactgctttacttgctaaagcagttggcttaaccctggctagacacccc
caggtgaatgcagcttttagttctgaggggattgcctatccttcacaaataaatgtagcc
gttgcagttgcgatggaggacggagggttgataactccagtgctgcaaaatgctgataag
acgagccttgctgatttatccctacaatgggctgatcttgttaagcgtgcgaggaataag
caattagaaccgcaagaatatagcagtggaacgtttacactctcgaatctaggtatgttt
ggtgtggatcgttttgatgcaattctgcccccagggactggagcaattttagcggtagga
gcttcattgtctaaagttgttgcttctaaagatggttcgatttcaatcaaaaaacagatg
caagtaaatcttaccgctgatcacagagtgatatatggggctgatggagcactattcctg
aaggatttggcatacttaatcgaaaagaacccttatagcctttcgtcttga

DBGET integrated database retrieval system