KEGG   Prochlorococcus sp. MIT 0801: EW15_1079Help
Entry
EW15_1079         CDS       T03316                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
prm  Prochlorococcus sp. MIT 0801
Pathway
prm00790  Folate biosynthesis
prm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EW15_1079
Enzymes [BR:prm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     EW15_1079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind CAT_RBD
Motif
Other DBs
NCBI-ProteinID: AIQ97171
UniProt: A0A089PAI8
LinkDB All DBs
Position
complement(970026..970877)
Genome map
AA seq 283 aa AA seqDB search
MPELLTTKKSNNFPPKHWKQEIQLMAIVNITEDSFSDGGLYIDLPAAINHASLCINQGAH
ILDIGAQSTRPGASEVGPETEIKRLVPLIKELKLLHPQIPISVDTFHHSVAEKVLNIGAD
LVNDVSGGRHDPEIYNVIANNGSPYVLTHSRGNSKTMDSLAVYTNVVKDVKNELSNQIDL
ALSKGIKDEQIIIDPGIGFAKNVDQNLTLLRNLEEFVSMNYPVLIGASRKRFIGSVINET
DPNKRIFGMAAVASRCVSSGVDILRVHDIKEISQVVIMTKSII
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
ttgccagaattgctaactacgaaaaaatctaataatttcccgcctaagcattggaaacaa
gaaatccaattaatggcaatagtaaacatcactgaagattcttttagtgatggaggactt
tacatagacttacccgctgcaattaatcatgcatcattatgtattaatcaaggagcacat
attctagatattggagcacagagcacacgacctggcgcatctgaggtaggtcctgaaact
gagattaaaagattagttccattaataaaagaactaaagttattacatccacagattcca
atttctgtagacacctttcatcattctgttgcagagaaagtattaaatattggtgccgat
ttggttaatgatgttagtggtggtcgacatgatcctgaaatctataatgttatcgctaat
aatggttctccttatgttttgactcatagtcgtggaaatagtaagacaatggattcttta
gctgtatatacaaatgttgtaaaagatgtaaaaaatgaattatccaatcaaattgattta
gcgctatccaaaggcattaaagacgagcaaattattattgatcctggaataggatttgca
aagaatgtcgatcaaaacttaactttgctgagaaatttagaagaatttgtttctatgaat
tatccagtattgataggtgcttcaagaaaaagatttattggttcagttattaatgaaact
gacccaaataaaagaatctttgggatggctgccgtagcatctagatgtgtgagttctggt
gttgatattctaagagttcatgatattaaagagatttctcaagttgtaataatgactaag
tcaattatttaa

DBGET integrated database retrieval system