KEGG   Prochlorococcus sp. MIT 0801: EW15_2094Help
Entry
EW15_2094         CDS       T03316                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
prm  Prochlorococcus sp. MIT 0801
Pathway
prm00620  Pyruvate metabolism
prm00680  Methane metabolism
prm00710  Carbon fixation in photosynthetic organisms
prm01100  Metabolic pathways
prm01120  Microbial metabolism in diverse environments
prm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:prm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EW15_2094
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    EW15_2094
   00680 Methane metabolism
    EW15_2094
Enzymes [BR:prm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     EW15_2094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 GAPES4
Motif
Other DBs
NCBI-ProteinID: AIQ98186
UniProt: A0A089PD94
LinkDB All DBs
Position
complement(1712559..1715543)
Genome map
AA seq 994 aa AA seqDB search
MLKNPSNENISNHSTVCVEDQDPGSLLQQRLELVEDLWKTVLKSECPPDQTERLLRLKQL
SDPSKSNQDNSSQAIVQLITKMDLAEAISAARAFSLYFQLVNILEQRIEEDSYLESIEKG
KLDNSNSQIDPFAPALASQTAPATFTQLFERLRRLNVPPAQLDGLMREMDIRLVFTAHPT
EIVRHTVRHKQRRVATLLQQLQSNSLISESEKEIFRLQLEEEIRLWWRTDELHQFKPTVL
DEVDYALHYFQQVLFDAMPQLRRRLTTALASSYPDVEIPNEAFCTFGSWVGSDRDGNPSV
TPEITWRTACYQRQLMLDRYIASVQELRDQLSISMQWSQVSSPLLESLEMDRVRFPDVYE
ERAARYRLEPYRLKLSYTLERLRLTQLRNKQLADAGWQFSPDGKPLISTDNSFDEFLHYK
SVDELKNELELIRNSLVSTDLTCEPLDTLLNQVHIFGFSLASLDIRQESTRHSDALDELT
CYLDLPESYGAMSEESRVQWLMKELKTRRPLIPPAFEWSKSTQETISVFHMLHRLQKEFG
TRICRSYVISMSHTASDLLEVLLLAKESGLIDPTLGASDFLVVPLFETVEDLQHAPSVME
SLLQTDVYRELLPRVGEKKQPLQELMLGYSDSNKDSGFLSSNWEIHKAQIALQDLASRQG
IALRIFHGRGGSVGRGGGPAYQAILAQPSGTLQGRIKITEQGEVLASKYSLPELALYNLE
TVTTAVIQNSLVTNKLDATPSWNELMTRLAARSREHYRALVHDNPDLVQFFQVVTPIEEI
SKLQISSRPARRKSGAKDLSSLRAIPWVFGWTQSRFLLPSWFGVGTALATELKTDPDQME
MLRMLNQRWPFFRMLISKVEMTLSKVDLDVAHHYMVSLGGGDDRDAFAAIFDIISSEYTL
TKKLILEITDKSKLLSADPALQLSVNLRNRTIVPLGFLQVALLKRLRDQNRQPPISEDMS
SDSTQSSRTYSRSELLRGALLTINGIAAGMRNTG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaatccttctaacgaaaatatctctaatcactcgacagtatgtgttgaggat
caagatcctggatctttattgcaacaaaggcttgaactagttgaggatctatggaaaacc
gttctcaaaagtgaatgtccacctgatcaaaccgagagattattgcgattaaaacaatta
agtgaccctagcaagtcaaatcaagataattcctcacaggcaatagtccaattgattaca
aaaatggatttagctgaggcgatatctgctgctagggctttttctctttattttcagttg
gtaaatattctggagcaacgtatagaagaggatagttatttagaaagcatagaaaaaggg
aagctagacaatagtaattctcaaatagatccattcgctccagctttagctagtcagact
gctccagcaacttttacacaattatttgagagattacgtcgtttgaatgtgcctccagct
cagcttgatggtttgatgagggaaatggatattcgtcttgtttttacagctcatccaact
gaaatagttagacatactgtccgccataagcaacgaagggttgcaactcttttgcagcaa
cttcaatctaatagtttaatttccgaatcggagaaagaaatatttaggttgcaactagag
gaggagataaggctttggtggagaaccgatgagcttcatcaatttaaaccgactgttctt
gatgaggttgactatgcccttcattattttcagcaggttttgtttgatgccatgcctcaa
ttaagaaggagactgaccactgcacttgcttcaagttatccagacgtagagatccctaat
gaagctttttgtacgtttgggtcttgggtaggctcggatcgtgatgggaatccatctgtt
actcctgaaatcacatggagaacagcctgttaccaaagacaattaatgttggatagatac
attgcatcagtccaagagttaagagaccaactgagtatatctatgcaatggagtcaagta
agttctcctttgctagagtcattagaaatggatagagttcgtttccccgatgtctatgag
gaaagggctgctagatatcgactggaaccttatcgattgaagcttagctatacacttgag
agactacgacttactcagctacgtaataagcagctagcggatgctggatggcaattctca
cctgatggaaagcctttaatatctaccgataatagttttgatgaatttctccactacaaa
tctgtagatgaattaaagaatgaattagagcttattagaaatagtctagtaagtacagat
ctaacgtgtgaaccactagatactttgctaaatcaagttcatatctttggtttctctttg
gctagcttagatattaggcaagaaagcacacgacatagtgatgctttggatgagctcact
tgctatttagatctacctgagtcgtatggagcgatgagcgaggaaagtcgagttcaatgg
ttgatgaaagaattaaaaactcggagaccactgattcctcctgcttttgagtggtcaaaa
agtactcaagaaactatctcggtttttcatatgcttcataggcttcagaaagaatttggt
actcgtatatgtcgctcgtatgtaatttcgatgagtcatacggcatcagatttattagaa
gttcttcttttagccaaagagtccggtttgattgatccaactttaggagcttctgatttt
ctcgttgttccattatttgaaacggttgaggatttacaacatgctccctctgtaatggag
tcgttgctccagacagatgtttatcgtgaattacttccacgagtaggagagaaaaaacaa
ccgcttcaggaacttatgcttggatactctgatagtaataaggattctggttttctctca
agtaattgggaaattcataaggctcaaattgcactccaagacttagctagtagacaagga
atagcattacgtatttttcatggtagaggagggtctgtaggaagaggcggtggaccagct
tatcaagctattttggctcaacctagtggtacactccaaggacgtataaaaataacagag
caaggagaagttcttgcctcaaaatatagtcttccagaattagctttatataatcttgaa
actgtaactacagcagttattcaaaatagcttagttaccaataaattggatgctacacca
agttggaatgaattgatgaccagacttgcagctcgttcaagggagcattaccgagcttta
gttcacgacaatccagatttggttcaattttttcaagtagttactccaatagaagagatt
agtaagttgcaaatttctagtcgtcctgcccgacgaaagagtggtgcaaaagacttatca
agccttcgagctatcccatgggtctttggttggactcaaagtcgttttctcttgccaagt
tggtttggtgttggtacggctttagctactgaattaaagacagaccccgaccaaatggag
atgttgcgaatgttgaatcagagatggccattctttagaatgttgatctctaaagttgag
atgacactctcaaaagttgatttagatgttgcccatcattatatggttagtttaggtggc
ggtgatgatcgggatgctttcgctgcaattttcgatattatttcaagcgaatataccttg
actaagaaattaattttagaaattactgacaagtcaaaactattaagcgcagaccctgct
ttgcagttatctgtcaacctgagaaatcggactattgtacctttaggatttttacaagtt
gctcttcttaaacgcttaagagatcagaaccgtcaaccaccaattagtgaggatatgagt
agtgactctactcaaagttcacgtacatatagccgtagtgaattattgcgtggtgcattg
ttgactataaatggtattgctgcaggtatgagaaacacaggatga

DBGET integrated database retrieval system