KEGG   Polaribacter reichenbachii: BW723_04030Help
Entry
BW723_04030       CDS       T04692                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
Organism
prn  Polaribacter reichenbachii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C AdoHcyase_NAD Pyr_redox_2 HI0933_like Pyr_redox UDPG_MGDP_dh_N TrkA_N 3HCDH_N ADH_N_2 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: APZ45514
UniProt: A0A1B8TV79
LinkDB All DBs
Position
complement(961211..962227)
Genome map
AA seq 338 aa AA seqDB search
MRATQYEGNKTFSVLEKEITEPQPSEVRIKVAYVGVCGTDVHIYHGMMDKRVSMPETIGH
EMSGVIDAVGAGVTDFSVGEKVVVRPLDDRKVKASDKGFNHICEELKFIGIDSPGAMQQY
WNVPAFTLHKLKETTDLKLAALIEPLSVAAHDVRLSGLVEGETAVVLGGGPIGLLVAMVA
KETGAQVIISEVNPKRIAKAKELGFDAVSPIDIDLIAYVKEKTDGRLADVVFEVAGVQPA
LDVMTELAGIRGRIVMVAIHGEKKPVDLFKFFWKELKLIGARVYEKEDYEKSIQLITANE
LPFEEMITDVQPLSNIQQVFENIDNNPDGLKVLMDCQL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaacacaatatgagggtaataaaacctttagtgtcttagaaaaagaaattact
gaaccacaaccaagtgaagttagaataaaagtagcttatgttggtgtttgtggtacagat
gtgcatatttatcatggtatgatggataagagagtttctatgccagaaacaattggtcat
gaaatgtctggagttatagatgcagttggtgcaggtgtaaccgatttttctgttggcgaa
aaagtagttgttagacctttagatgatagaaaagtgaaagcatcagacaaaggatttaat
catatttgcgaagaattaaaatttattggtatagatagtccaggagcaatgcaacagtat
tggaatgttcctgcatttacacttcacaaattaaaagaaactacagatttaaaattagca
gctttaatagagcctttatcagtagcagcgcatgatgtacgtttaagcggattagtagaa
ggagaaactgctgtagttttaggtggcggaccaattggtttattagtagctatggttgct
aaagaaactggtgctcaagtaataatttctgaagtaaacccaaaaagaattgcaaaagca
aaagaattaggtttcgatgctgtaagccctattgatatagatttaatagcttatgtaaaa
gaaaaaacagatggtcgcttagcagatgtggtttttgaagttgctggtgtacaacctgct
ttagatgttatgacagagcttgctggtataagaggtagaattgtaatggtggctattcat
ggagaaaaaaagccagtagatttatttaaatttttctggaaagaattaaaattgatagga
gccagagtgtatgaaaaagaagactatgaaaaatcaattcaattaattacggcaaacgaa
ttgcctttcgaagaaatgattacagatgtgcaaccattaagtaacattcaacaagttttt
gaaaatatagataataatcctgacggattaaaagtattaatggattgtcaattataa

DBGET integrated database retrieval system