KEGG   Polaribacter reichenbachii: BW723_04030
Entry
BW723_04030       CDS       T04692                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
prn  Polaribacter reichenbachii
Pathway
prn00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:prn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BW723_04030
Enzymes [BR:prn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BW723_04030
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BW723_04030
    1.1.1.-  
     BW723_04030
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C AdoHcyase_NAD Pyr_redox_2 HI0933_like Pyr_redox UDPG_MGDP_dh_N TrkA_N 3HCDH_N ADH_N_2 Pyr_redox_3
Other DBs
NCBI-ProteinID: APZ45514
LinkDB
Position
complement(961211..962227)
AA seq 338 aa
MRATQYEGNKTFSVLEKEITEPQPSEVRIKVAYVGVCGTDVHIYHGMMDKRVSMPETIGH
EMSGVIDAVGAGVTDFSVGEKVVVRPLDDRKVKASDKGFNHICEELKFIGIDSPGAMQQY
WNVPAFTLHKLKETTDLKLAALIEPLSVAAHDVRLSGLVEGETAVVLGGGPIGLLVAMVA
KETGAQVIISEVNPKRIAKAKELGFDAVSPIDIDLIAYVKEKTDGRLADVVFEVAGVQPA
LDVMTELAGIRGRIVMVAIHGEKKPVDLFKFFWKELKLIGARVYEKEDYEKSIQLITANE
LPFEEMITDVQPLSNIQQVFENIDNNPDGLKVLMDCQL
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgagagcaacacaatatgagggtaataaaacctttagtgtcttagaaaaagaaattact
gaaccacaaccaagtgaagttagaataaaagtagcttatgttggtgtttgtggtacagat
gtgcatatttatcatggtatgatggataagagagtttctatgccagaaacaattggtcat
gaaatgtctggagttatagatgcagttggtgcaggtgtaaccgatttttctgttggcgaa
aaagtagttgttagacctttagatgatagaaaagtgaaagcatcagacaaaggatttaat
catatttgcgaagaattaaaatttattggtatagatagtccaggagcaatgcaacagtat
tggaatgttcctgcatttacacttcacaaattaaaagaaactacagatttaaaattagca
gctttaatagagcctttatcagtagcagcgcatgatgtacgtttaagcggattagtagaa
ggagaaactgctgtagttttaggtggcggaccaattggtttattagtagctatggttgct
aaagaaactggtgctcaagtaataatttctgaagtaaacccaaaaagaattgcaaaagca
aaagaattaggtttcgatgctgtaagccctattgatatagatttaatagcttatgtaaaa
gaaaaaacagatggtcgcttagcagatgtggtttttgaagttgctggtgtacaacctgct
ttagatgttatgacagagcttgctggtataagaggtagaattgtaatggtggctattcat
ggagaaaaaaagccagtagatttatttaaatttttctggaaagaattaaaattgatagga
gccagagtgtatgaaaaagaagactatgaaaaatcaattcaattaattacggcaaacgaa
ttgcctttcgaagaaatgattacagatgtgcaaccattaagtaacattcaacaagttttt
gaaaatatagataataatcctgacggattaaaagtattaatggattgtcaattataa

DBGET integrated database retrieval system