KEGG   Polaribacter reichenbachii: BW723_07430Help
Entry
BW723_07430       CDS       T04692                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
prn  Polaribacter reichenbachii
Pathway
prn00620  Pyruvate metabolism
prn00680  Methane metabolism
prn01100  Metabolic pathways
prn01120  Microbial metabolism in diverse environments
prn01200  Carbon metabolism
Module
prn_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:prn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BW723_07430
  09102 Energy metabolism
   00680 Methane metabolism
    BW723_07430
Enzymes [BR:prn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BW723_07430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 ECH_1 DUF4378
Motif
Other DBs
NCBI-ProteinID: APZ46138
UniProt: A0A1B8U6F1
LinkDB All DBs
Position
complement(1809680..1812259)
Genome map
AA seq 859 aa AA seqDB search
MSALPKLTRFNDNVLSKYQIYNSIFTTLPFDTIDDTGVLLPLLHKVCESGFKLEKNPTEI
VEHFFKKYQENPTEKEKSDLLFRFIQFIERQVVLFDAIEDAAFPIVNNMDGFGTLRNSKE
TAFLSNKKDELKAHLEDFKVRIVLTAHPTQFYPGTILGIITDLDKAIQNDDLLLIKKLLA
QLGKTPFYKKEKPTPFDEAVSLVWYLEHVFYHSVPKIYNYIQHHIYDGKPIDNEIIDLGF
WPGGDRDGNPFVTTKITLDVAEKLRQTILRSYYRDVRRLKRRFTFDGVQDILARIEKRLY
KHVVRSYSKVNFSQKILLEELYNARQIIVDKHQSLFVEELNDFINKVRIFGFHFATLDIR
QDSRVHHKAFVQIVKDLQEQGDTTFPDNYLNLTAEEQINILSVIKGNIDPSILSDETSVK
TIESIYALKEIQQRNGERGANRYIISNNQTALNVMETFAMLNLCGFENELPVDVIPLFET
VEDLENAEEVMRILYNNKTYRYHLSKRKDKQTIMLGFSDGTKDGGYLMANWGIFKAKEAL
TRISREFDIEVIFFDGRGGPPARGGGKTHQFYASLGPTIEDKEIQLTIQGQTISSNFGTL
NSSQYNLEQLISSGIKNEVFTKDQLNDHHREIIEDLASTSYQAYVDFKNHPQFLSYLEKM
STLKYYAKTNIGSRPSKRSNSDTLDFSALRAIPFVGSWSQLKQNVPGFFGVGTAFKKYED
EGRFDEIVDFYNASDFFKTLLENSMMSLTKSFFGLTAYMADDPVFGEFWKLIFEEYKTTK
RLLLKLTGHKELMENFPVGKASIELRENIVLPLLTIQQYALKKIQDLQKEEGNEVEIEIY
EKMVMRSLFGNINASRNSA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcattacccaaattgacaagatttaacgataatgtgttatctaaataccaaatt
tataacagtatttttacaacacttccttttgacacgattgatgatacaggagtattactt
cctttactacataaagtctgtgaatctggttttaaactagaaaagaaccctactgaaata
gtagaacatttttttaaaaaataccaagaaaatccaacagaaaaagaaaaatcagatttg
ctttttcgcttcattcaatttattgagcgtcaagtagttttattcgatgctattgaagat
gcagctttccctattgtaaataatatggatggttttggaacactaagaaactctaaagaa
actgcatttcttagcaataaaaaagacgaattaaaagcgcatttagaagattttaaggta
cgtattgtattaactgcacatccaactcagttttatcctggtacaattttagggataatt
acagatttagataaagccatacaaaatgacgatttacttttaatcaaaaaattattagct
caattaggtaaaacacctttttataaaaaagaaaaacctactccttttgatgaagctgta
agtttagtttggtacttagagcacgttttttatcattcagtacctaaaatatacaactat
attcaacatcatatttatgatggtaaacctatagataacgaaattattgatcttggtttt
tggccaggaggagatagagatggtaatccttttgtaactacaaaaatcactttagatgtt
gcagaaaaattgcgtcaaacaattttaagaagttattatagagatgtaagacgccttaaa
agacgttttacttttgatggcgtacaagacattttagcaagaattgaaaaaagactttac
aaacacgtagttagaagttattctaaagttaatttctctcagaaaattcttttagaagag
ctttataatgctagacaaattattgttgataaacatcaatctctatttgtagaagaacta
aacgattttattaacaaagtaagaatctttggttttcattttgctactttagatattaga
caagatagtagagtacatcataaagcatttgtacaaattgtaaaagatttacaagaacaa
ggcgatactactttcccagacaattatttaaacttaacagcagaagaacaaataaacatt
ttatctgtaattaaaggtaatatagacccaagtattttgtctgatgaaacatcagtaaaa
acaatagaatctatttatgctttaaaagaaattcagcaaagaaatggagaacgtggtgca
aatcgttacataattagtaacaaccaaactgcattaaacgttatggaaacttttgcaatg
cttaatttatgtgggttcgaaaatgagttacctgtagatgtaattccgctttttgaaact
gtagaagatttagaaaatgcagaagaagtaatgcgtattttatataacaataaaacctat
agatatcatttatctaaaagaaaagacaaacaaaccataatgttaggtttttctgatgga
acaaaagatggtggttatttaatggcaaattggggaatttttaaagcaaaagaagcctta
actagaatttctagagaatttgatattgaagtaattttctttgacggacgtggaggacca
cctgcacgtggaggaggaaaaacacaccaattctatgcttctttaggcccaacaatcgaa
gacaaagaaattcaattaaccattcaaggccaaacaattagttctaattttggaacctta
aattcatcgcaatataacttagaacaattaataagttcgggtattaaaaacgaagtattt
acaaaagatcagctaaatgatcatcatagagaaattatagaagatttagcatctacaagt
tatcaagcttatgtagattttaagaatcatcctcagtttttatcgtacttagaaaaaatg
agtactttaaaatactatgctaaaacaaatattggtagtagaccaagtaagcgttctaat
tcagatactttagatttttctgctttaagagcaataccttttgttggtagttggagccag
ttaaaacaaaatgttcctggattttttggtgtaggtactgcatttaaaaaatacgaagat
gaaggtagatttgatgaaattgtagatttctataacgcatcagatttctttaaaacttta
ttagaaaacagtatgatgagtttaacaaaatctttctttggtttaacagcttacatggct
gatgatcctgtatttggagaattttggaaactaatcttcgaagagtataaaactacaaaa
cgtctattattaaagttaacaggccataaagaattaatggaaaatttccctgtaggtaaa
gcttctatagaattaagagaaaatattgttttaccattgttaactattcagcaatatgct
ttaaagaaaattcaagatttacaaaaagaagaaggtaatgaagtagaaattgaaatctat
gaaaaaatggtaatgcgttctttatttggaaacattaatgcgagtagaaattcggcttaa

DBGET integrated database retrieval system