KEGG   Polaribacter reichenbachii: BW723_07585Help
Entry
BW723_07585       CDS       T04692                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
prn  Polaribacter reichenbachii
Pathway
prn00240  Pyrimidine metabolism
prn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BW723_07585
Enzymes [BR:prn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BW723_07585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: APZ46166
UniProt: A0A1B8U6C4
LinkDB All DBs
Position
complement(1840489..1841082)
Genome map
AA seq 197 aa AA seqDB search
MFLENTVNHTEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPEVDTRYDDEE
VVSHNDSRIRSTPVPVSSNIRLLANNVDVVGIDEAQFFDDEIVAVCNDLANRGIRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTHTGNLAHYSFRKAQNDKLVMLGETQEYEP
LSRAAYYKAVKKKQEET
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaatacagtaaatcatactgaacaatttggctggatagaagtaatttgt
ggttctatgttttctggcaagacagaagagttaatcagacgtttaaaacgtgcccaattt
gctaagcaaaaagtagagatttttaaacccgaagttgatactagatatgatgatgaggaa
gtagtttctcataacgattctagaataagatctacacctgtacccgtttcatcgaacata
aggcttttagcaaacaatgtagatgttgttggtattgatgaggctcagttttttgatgat
gaaatagtagctgtttgtaacgatttagcaaacagaggtatacgtgtaattgttgcaggt
ttagatatggattttaaaggaaatccttttgggccaatgcctgcattaatggcaacagca
gaatatgtaactaaagtacacgctgtttgtacacatacaggaaatttagcccattatagc
tttagaaaagcgcaaaacgacaaattagtaatgcttggagaaactcaagaatacgaacct
ttaagtagagctgcttattataaagctgttaaaaagaagcaagaagaaacttag

DBGET integrated database retrieval system