KEGG   Polaribacter reichenbachii: BW723_10885Help
Entry
BW723_10885       CDS       T04692                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
prn  Polaribacter reichenbachii
Pathway
prn00061  Fatty acid biosynthesis
prn00780  Biotin metabolism
prn01100  Metabolic pathways
prn01130  Biosynthesis of antibiotics
prn01212  Fatty acid metabolism
Module
prn_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:prn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BW723_10885
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BW723_10885
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BW723_10885
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:prn01004]
    BW723_10885
Enzymes [BR:prn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BW723_10885
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BW723_10885
Lipid biosynthesis proteins [BR:prn01004]
 Fatty acid synthase
  Component type
   BW723_10885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: APZ46756
UniProt: A0A1B8TQ12
LinkDB All DBs
Position
2601039..2601845
Genome map
AA seq 268 aa AA seqDB search
MYNLLKGKKGIIFGALNEQSIAWKVAERAHEEGAEFVLTNAPIALRMGQLNALAEKTGSQ
VIAADATSLEDITALVEQSMEILGGKIDFVLHSIGMSVNVRKKIHYTDSNYDFTAKGWDI
SALSFHKVMNVLYNKKAMSEWGSIVALTYMAAQRVFPDYNDMADNKAYLESIARSFGYFF
GRDHKVRVNTISQSPTPTTAGSGVKGFDGFIEYAEKMSPLGNASALECADYTISMFSDLT
KKVTMQNLFHDGGFSNMGVSDPVMEKFE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtacaatttattaaaaggtaaaaaaggaattattttcggagctttaaacgagcaatct
attgcttggaaagtagcagaaagagcacacgaagaaggcgcagaatttgtattaacaaat
gcaccaattgctttaagaatggggcaattaaatgcattagcagaaaaaactggttcgcaa
gttattgctgcagatgcaacttctttagaagatattactgctttagtagagcaatctatg
gagattttaggtggtaaaatcgacttcgttttacactcaattggtatgtctgtaaacgtt
agaaaaaaaatacattatacagactctaattacgattttacagcaaaaggttgggacatt
tctgcactttcttttcataaagtaatgaatgttttatacaacaaaaaggcaatgtctgaa
tggggttctatagtagcgttaacatatatggctgcacaaagagtttttccagattataat
gatatggcagacaacaaagcctatttagagagtattgcacgtagttttggctactttttt
ggtagagatcacaaggttcgtgtaaatacaatttctcaatcgccaacaccaactacagca
ggtagtggagtaaaaggttttgatggttttatagaatacgcagaaaaaatgagtccttta
ggtaatgcatctgctctagaatgtgcagattataccatttctatgttctcagatttaact
aaaaaagtaacaatgcagaacttatttcacgatggtggattctcaaatatgggagtaagc
gatcctgttatggaaaagtttgagtag

DBGET integrated database retrieval system