KEGG   Prevotella sp. oral taxon 299: HMPREF0669_00101Help
Entry
HMPREF0669_00101  CDS       T02809                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pro  Prevotella sp. oral taxon 299
Brite
KEGG Orthology (KO) [BR:pro00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HMPREF0669_00101
Enzymes [BR:pro01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HMPREF0669_00101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like Thi4 DAO FAD_oxidored AlaDh_PNT_C NAD_binding_8 Lycopene_cycl Glutaredoxin FAD_binding_3 Thioredoxin_4 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: EFC71429
UniProt: D3I9J7
LinkDB All DBs
Position
unnamed:complement(327819..329381)
Genome map
AA seq 520 aa AA seqDB search
MLDKQIIEQVRGIFSALEGQYTLSLTFNKDFEELNNMRSFLSDFASSSEKINVEEHETTE
NTLYFDIVKNGTPTGIRFRGIPNGHEFTSLLLAILNSDGKGKNLPDANICKRVAAINGEI
HIQTYVSLTCTNCPDVVQALNIMALNNPAITHEMIDGALFQAEVEAKHIQGVPAVFIDGE
LVHSGKGEFGELLQKLEDKFGSSTQSNEPQEEQNYDVIVLGGGPAGSSAAIYSARKGLKV
AIIAESIGGQVKETVGIENLISVPQTTGAKLASDLKEHVRTYPIDVFENRKIENVSLKDA
QKRIIVRGGETFVAPAVIIATGASWRKLNVEGESDYLGKGVHFCPHCDGPFYKDKAVAVI
GGGNSGIEAAIDLANICSNVTVLEFADTLRADEVLQNKAASMPNIQIFKSSQTTQVIGNG
TKVTALKVKDRVTNEEREITLDGVFVQIGLSANSAPFAEELTLTNAREIVIDAHCRTSIP
GVYAAGDVSSVPYKQIVIAMGEGAKASLSAFEDKMRGVIG
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctagataaacaaataattgaacaagtaagaggtatttttagtgcccttgagggacaa
tacaccttatcattaactttcaataaagactttgaagaactcaataatatgcgttctttc
ttgtcagactttgcttcttcatctgaaaagataaatgtagaagaacacgaaaccacagaa
aacactctttatttcgatatcgttaagaatggaactcctacaggaatccgttttagaggt
attcctaatggacacgagtttacatctcttcttcttgcaattcttaactcagatggtaaa
ggaaagaatcttcctgatgccaatatatgcaaacgtgtggctgcaattaatggtgaaata
catattcaaacctatgtatctctaacctgtaccaattgccctgacgttgtacaagcactc
aacatcatggctttgaacaatcctgctatcacccatgagatgattgatggagctttattt
caagctgaagtggaagcaaaacacattcaaggtgtacccgcagtgttcattgatggtgag
ctagttcattctggtaaaggtgaatttggagagctattacagaaattagaagataagttt
ggctcttcaactcaaagtaatgagcctcaagaagaacaaaactacgatgtaattgtattg
ggtggaggtcctgcaggttcatctgctgccatctattcagcacgtaaaggactaaaagta
gctatcattgcagaaagcattggtggacaagttaaggaaacagtaggcatcgaaaacctt
atatctgttcctcaaacaacaggtgctaagcttgcttctgacttaaaagagcatgttcgc
acttatcctattgatgtctttgaaaaccgcaaaatagaaaatgtttcactaaaagacgca
caaaaacgcattatagttagaggcggagaaactttcgttgcgcctgcagttatcattgca
acaggtgcaagttggcgtaaacttaatgtggaaggcgaaagcgattacttaggtaaaggt
gtgcatttctgccctcattgcgatggacctttctacaaagacaaggcagtagcagtgatt
ggaggtggcaactcgggtatagaagctgcaatagaccttgctaatatctgctcaaatgtt
actgttttggaatttgccgacacactaagagccgacgaagtgctacaaaacaaggctgca
agtatgcctaacatacaaatatttaagtcgtctcaaacaactcaagtaataggaaatggc
actaaggttacagccttaaaggtgaaagatagagttacaaatgaagaacgagagattact
cttgatggtgtatttgtacaaatcggactatcggctaacagtgctcctttcgcagaagaa
ctcacacttacgaatgcaagagaaatagttattgatgctcattgccgtacttctattcct
ggagtgtatgctgctggcgacgtatcaagcgtgccttacaagcaaattgtcattgctatg
ggagaaggagcaaaagcttctttatctgcattcgaagacaaaatgcgtggcgttatcggt
taa

DBGET integrated database retrieval system