KEGG   Prevotella sp. oral taxon 299: HMPREF0669_00284Help
Entry
HMPREF0669_00284  CDS       T02809                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pro  Prevotella sp. oral taxon 299
Pathway
pro00473  D-Alanine metabolism
pro01100  Metabolic pathways
pro01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HMPREF0669_00284
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    HMPREF0669_00284
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pro01011]
    HMPREF0669_00284
Enzymes [BR:pro01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HMPREF0669_00284
Peptidoglycan biosynthesis and degradation proteins [BR:pro01011]
 Precursor biosynthesis
  Racemase
   HMPREF0669_00284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase
Motif
Other DBs
NCBI-ProteinID: EFC71612
UniProt: D3IA30
LinkDB All DBs
Position
unnamed:520370..522847
Genome map
AA seq 825 aa AA seqDB search
MTYTIERITALIGARRYGRANASIVFLLTDSRSLCFAEETLFFAIKTMSNDGSKYLSDLY
KRGVRNFVVNEVPENYAVLYPNSNFLKVSNTLDALQRLAERHRDEFAIPVIGITGSNGKT
MVKEWIYQLLSPSLIVTRSPRSYNSQTGVPLSVWLLTNNTQLGVFEAGISEPGEMDSLRD
IIQPTIGILTTIGDAHQENFTSLEEKCNEKLKLFTDSKLLIYNEDNTLVKRCVEQFSFEG
QRFSLSRQNEKSTLYVSKVLKNNADSVIYYSYKGVEGSYKIPFIDEASIENSIECLAIGL
YLGIDKNAIEERMASLEPVAMRLEVKEGRHDCTLINDSYNSDINSLDIALDFMSRRPDAK
ERQRILILSDIYQTGKPLSQLYSEVSALMKQRSVNQFIGIGPEIYAHQDCFQQQNSSFFL
TVQDFIDSGLFTNLRNNIILLKGARRFGFDKITDLLVKKVHETTLEVNLSALVQNLNFYR
SYLKQDTKLVCMIKANGYGLGAVEVAKTLQDHRVDYLAVAVADEGVALRKHGVTANIMIM
NPEMSSFKTIFDYELEPEVYSFRLLEALIEEAEKEGITQYPIHIKLDTGMHRLGFDPIND
IERLISILKKHQNTIIPRSVFSHFVGSDSDHFDDFSAQQFSLFDTASKQLQSAFTHHILR
HINNSAGILHFPDRQLDMCRLGLGLYGINSRDNQIINNVCSLRTTILQMHKIGSNETVGY
SRKGTVERETIVAAIPIGYADGLDRRLGNRNCYCLVNGHKAPYLGNICMDVAMIDVTDIP
CKEGDSVEIFGDNLPVTVLSDTLDTIPYEVLTSISERVKRVYFQD
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgacttatacaattgagagaataacagcattgataggagcacgccgatatggtagagct
aatgcttctattgtattcttattaacagacagtaggtcgttatgttttgcagaagaaaca
ttgttttttgccataaaaacaatgagtaatgacggaagtaaatatttatctgacttgtat
aagcgtggtgttcgcaactttgtagtgaacgaagtaccagaaaattatgcggtattatat
cctaattccaattttcttaaggtctcaaatacccttgatgccctccaaagattagccgaa
agacatcgtgatgagtttgctattccagtgataggaataactggcagcaatggaaaaaca
atggtgaaagaatggatttatcagcttctttcgccttcattgattgttactcgcagtcca
agaagctataattcgcaaacgggagtacccctttctgtatggttattaactaacaatact
cagctaggagtgttcgaagcaggaataagtgagcctggagaaatggactcattgcgtgac
attattcagccaacaataggtatattaacaaccataggcgatgcacatcaggagaatttc
acttctttagaagagaaatgtaacgagaaattaaagctatttacagactcaaaacttctt
atttataatgaagataatactttagtgaaacgttgtgtagagcaattttcatttgaagga
caacgcttttcgttatcaagacagaatgaaaagtctactctttatgtttctaaagttttg
aaaaacaatgcagatagcgttatatattattcatataaaggtgtagaaggcagttataag
ataccttttattgatgaagcttctatcgagaattctattgaatgtttagctattggttta
tacttaggtattgataagaatgcaatagaagagcgaatggcatctttagagcctgttgct
atgcgcttagaggtgaaagaaggcagacatgattgtacgcttattaacgattcttacaat
tcagatatcaactcgcttgatattgctttagactttatgagtcgtcgcccagatgctaaa
gagcgtcaaagaatattgatattaagcgacatttatcaaacaggaaagccgctttcccag
ctttatagcgaggtttctgcgttgatgaaacaacgaagtgtgaatcaatttattggtatt
ggacctgaaatatatgcgcatcaggattgtttccaacaacaaaatagctcattctttcta
acagttcaagactttattgatagcggattatttacgaatttgcgtaataacatcatttta
ttaaagggagcacgtcgctttggtttcgataaaataaccgatcttttggtaaagaaagtg
cacgaaacaacattggaagtgaatctaagtgctttggttcagaatcttaatttctatcgt
tcttatttgaaacaagatacgaaattggtatgtatgattaaggcaaatggctatggtttg
ggggctgttgaggtggcaaagacccttcaagaccatcgagttgactatcttgcagtggct
gttgccgatgaaggtgtggcattaagaaagcatggtgttactgcaaacatcatgataatg
aatcctgagatgtcgtcttttaaaacgatattcgattatgaactcgagccagaagtatat
tcattccgtcttttagaggctttaattgaagaagcagagaaagaaggaatcactcaatat
ccaatacatattaagctcgatacgggtatgcatagattgggatttgacccaattaacgat
atagaacgattgatatcgattttgaagaagcatcaaaacacaattattccacgtagtgtt
ttctcacattttgtaggttctgatagtgaccattttgatgatttttctgcacaacaattc
agtcttttcgatacagcaagtaagcaattgcaatctgctttcacgcatcatatattacga
cacatcaacaatagtgcgggaatacttcactttcccgaccgacaactcgatatgtgtaga
cttggtttgggcttatatggtatcaatagtcgtgataatcagattataaataacgtgtgt
tcattgcgtacaaccatattgcaaatgcataaaattggtagcaatgaaaccgtaggatat
agtcgaaagggtactgttgagcgtgaaactatagtggcagcaataccgattggttatgca
gatggattggatagacgtcttggaaacagaaattgttactgcttagtgaatggacataag
gctccatatttgggcaatatatgtatggatgttgcaatgattgatgttacagacatacct
tgtaaagaaggagatagcgtggaaatatttggcgataacttacccgttacagtgctatca
gacaccttagacaccattccttatgaagttttgacctctataagcgaacgagttaagaga
gtatatttccaagattag

DBGET integrated database retrieval system