KEGG   Prevotella sp. oral taxon 299: HMPREF0669_01470Help
Entry
HMPREF0669_01470  CDS       T02809                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
pro  Prevotella sp. oral taxon 299
Brite
Translation factors [BR:pro03012]
 Eukaryotic Type
  Elongation factors
   HMPREF0669_01470
 Prokaryotic Type
   HMPREF0669_01470
Mitochondrial biogenesis [BR:pro03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    HMPREF0669_01470
Exosome [BR:pro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HMPREF0669_01470
  Exosomal proteins of breast cancer cells
   HMPREF0669_01470
  Exosomal proteins of colorectal cancer cells
   HMPREF0669_01470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 ATP_bind_1 RsgA_GTPase cobW G-alpha
Motif
Other DBs
NCBI-ProteinID: EFC70490
UniProt: D3IDG6
LinkDB All DBs
Position
658332..659522
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAISKVLHEKGFGSEEAKSFDQIDNAPEEKE
RGITINSAHIEYETANRHYAHVDCPGHADYVKNMVTGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVNVPRLVVFLNKCDMVDDAEMLDLVEMEVHEILEQYEYEEDTPIVRGSALGGL
NGVDKWVEKIVELMDTVDTWIQEPPRDMDKPFLMPIEDVFSITGRGTVATGRVETGRVKV
GDEVELLGLGEDKKCVVTGVEMFRKLLDEGVAGDNVGLLLRGIDKNEIKRGMVLCHPGQI
KPHKKFKASVYVLKKEEGGRHTPFGNKYRPQFYLRTMDCTGEITLPEGVEMVMPGDNVEI
TVELIYAVALNVGLRFAIREGGRTVGSGQITQILED
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagagaaattcgagcgtaccaaaccgcacgttaacgttggtacaattggtcac
gtagaccacggtaagacaactttgactgcagccatctctaaggtgttgcacgaaaaaggt
tttggttctgaagaagctaaatcatttgatcaaattgataacgctccagaagaaaaagaa
cgtggtattactattaactctgctcacattgagtatgaaacagctaatcgtcactatgca
cacgttgactgtcctggacacgctgactatgtgaaaaacatggtaactggtgctgctcag
atggatggtgctattcttgttgtagctgcaactgatggtcctatgcctcaaactcgtgag
cacgttcttcttgctcgtcaggtaaacgttcctcgtttggttgttttcttgaacaagtgc
gacatggttgatgatgcagaaatgctagacctagttgaaatggaagttcatgaaattctt
gaacaatacgaatatgaagaagatactcctatcgttcgtggttctgctctaggtggtttg
aatggcgttgataagtgggttgaaaagatcgtggaattgatggatactgttgatacatgg
attcaagagcctccacgtgatatggataaaccattcttgatgcctatcgaagacgtgttc
tcaatcacaggtcgtggtactgttgctactggtcgtgttgaaaccggtcgtgttaaagta
ggtgatgaagttgaacttctaggtcttggtgaagataagaaatgcgttgtaacaggtgtt
gaaatgttccgcaagcttcttgatgaaggtgttgctggtgataacgtaggtttgttactt
cgtggtattgataagaacgaaatcaaacgtggtatggttctttgtcacccaggtcagatt
aaacctcataagaaatttaaggcttcagtttacgtattgaagaaagaagaaggcggacgt
catactccattcggaaacaaataccgtcctcaattctacttacgtactatggactgtaca
ggtgaaatcacattgccagagggtgtagaaatggttatgcctggtgataacgttgagatc
actgtagaactaatctatgctgtagcattgaacgtaggtcttcgtttcgctattcgtgaa
ggtggacgtacagtaggttctggtcagattacacaaatccttgaagactaa

DBGET integrated database retrieval system