KEGG   Prosthecochloris sp. CIB 2401: Ptc2401_01225Help
Entry
Ptc2401_01225     CDS       T04424                                 

Gene name
sodB
Definition
(GenBank) Superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
proc  Prosthecochloris sp. CIB 2401
Brite
Enzymes [BR:proc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Ptc2401_01225 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ANT64998
UniProt: A0A1B1Q2F2
LinkDB All DBs
Position
1251296..1251901
Genome map
AA seq 201 aa AA seqDB search
MAYQQPELPYAQNALEPHISANTLSFHYGKHHATYVTKFNEMVAGTPFDDQSLEEVIMAT
AGDQSKAGIFNNGAQAWNHTFYWNSLSPNGGGKPSGSLASRIDEDFGSFDTCREELATAA
ATQFGSGWAWLVLANSKLEVRKTGNAANPMTEGATPILTIDVWEHAYYLDYQNRRPDYAA
ALIDNLLNWEFAQNNFDAATA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcataccagcaaccggaactcccctacgcacagaacgcactcgagccacatatctcg
gccaacaccctgagtttccactacggcaagcaccatgcaacctacgtcacgaaattcaac
gaaatggttgccggcacaccgttcgacgaccagagtctggaagaggtgatcatggcaacg
gctggcgaccagtcaaaggcagggattttcaataacggtgcacaggcatggaaccacacc
ttttactggaacagcctctcaccgaacggtggcgggaaaccctcgggcagccttgcctcc
agaatcgacgaagatttcggcagtttcgacacatgccgcgaagaactcgcaacagcagca
gcaacccagtttggcagcggatgggcctggctcgtacttgccaacagtaaactcgaagtc
cgtaaaaccggtaacgcagcaaatccaatgaccgaaggcgcaaccccgatcctgaccata
gatgtctgggaacacgcctactacctcgactaccagaaccgcaggcccgactatgcagca
gcactgatcgacaacctgctcaactgggagttcgcacagaacaacttcgacgcagcaaca
gcctga

DBGET integrated database retrieval system