KEGG   Prosthecochloris sp. GSB1: CHL67_01045Help
Entry
CHL67_01045       CDS       T04996                                 

Gene name
treS
Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pros  Prosthecochloris sp. GSB1
Pathway
pros00500  Starch and sucrose metabolism
pros01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pros00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CHL67_01045 (treS)
Enzymes [BR:pros01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CHL67_01045 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CHL67_01045 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ASQ89693
UniProt: A0A222SFD5
LinkDB All DBs
Position
208547..211861
Genome map
AA seq 1104 aa AA seqDB search
MPRASHKYCPEPLWYKDAIIYEAHVKTFFDSNNDGIGDFEGLRRKLPYLESLGITAIWLL
PFYPSPLRDDGYDIADYMEVNPDYGTVEDFKAFLDEAHDRGLKVITELVINHTSDQHAWF
QRARRAKPGSAERDFYVWADDPKKYAETRIIFQDFEASNWTWDPVAGQYFWHRFYHHQPD
LNFENPEVEKALYKVLDYWLDMGVDGLRLDAVPYLYEEEGTNCENLPRTHEFLRRLRRHV
DKKYPNRMLLAEANQWPEDAAEYFGEGDECHMNFHFPLMPRMYMALEMEDRFPIIDILDQ
TPEIPESSQWASFLRNHDELTLEMVTDEERDYMRRVYAHDPKARINLGIRRRLAPLMSND
RRKIELMNIMLLSLPGTPVLYYGDEIGMGDNFYLGDRDGVRTPMQWNGDRNAGFSRANPQ
QLQLPVIIDPEYHYEATNVEVQDASINSLLWWTRHMLSTSRRYKALSRGDIRFIDSHNPQ
ILVFTRTYEGETMLCVINLSRNAQAVGIDLSEYEGFTPEEVFSFTHFPGISSRPYTVTLG
PYGYFWFRLFRSEEEAGMRRYVEKPFAKAASLESLFSGRPLERFETRVLPEYIRGCRWFG
GKARKILRTKVLERIPLKGLEETEYLVVEVSYASGQNETYQLPVAFIPLEQFGEDEGPLL
KRVICMARIGEREGYLCDAAYEKAFRRFLLDMVVRKRIVKGTTGKLVAERGERLGEYLPE
EEDGVVSSLFGAEQSNTSIMYGDSLCLKLYRKISSGASPEIEICRTLTEKTLYANAPAYL
GAISFSRSRKDQFALGILQNFIPNEGDAWTVSLHYVHRYYEEVLAMPQATTVVPELPVIG
VKTVDMPEVMHSLIGEVYLDMVTRLAERTAGMHLALSDAGLGPDFSPEPFTTLYQRSIYQ
SMREQVKRGMVLLKGQLKGIDEEYRDLARSIIGCESEILDQLSHIKNRKVSASKIRIHGD
YHLGQVLYTGLDFVIIDFEGEPARSLSERRIKRSVFRDLAGMMRSFHYAAFNVLIQDRSI
RPEDVERLEPWAELWSFYTGQHFFDVYEAAVRGRGLVPEHATEQHLLLRGYLMDKAVYEL
NYELNNRPEWIGIALKGLQRLLAQ
NT seq 3315 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgagcatcgcacaagtactgcccggagccgctctggtacaaggatgccatcatc
tacgaggcacacgtcaagaccttcttcgacagcaacaacgacggaatcggtgatttcgag
ggccttcgccgaaagctcccgtatctcgaaagtctcgggatcaccgccatctggctgctg
cccttctatccgtccccgctgagggatgacggttacgacatcgccgactacatggaggtc
aaccccgattacgggacggtagaggatttcaaggcttttctcgacgaggcgcacgatcgg
gggctgaaggtcatcaccgagctcgtcattaaccacacctctgaccagcacgcctggttc
cagcgcgcccggagagcgaagccgggaagcgcagaacgcgatttctacgtctgggcggac
gatccgaagaagtatgcggaaacccgcatcattttccaggatttcgaagcctcgaactgg
acctgggacccggtcgccgggcagtatttctggcaccgtttctaccaccatcagcccgac
ctgaacttcgagaacccggaagtcgaaaaagcgctctacaaagtgctcgactactggctc
gacatgggcgtcgacggactgcggctcgatgccgtgccctatctttacgaggaggaaggc
accaactgcgaaaacctgccgcgcacccacgaatttctccgcaggctccgccgccacgtg
gacaaaaagtatcccaaccgcatgctgctcgccgaggcgaaccagtggcctgaagacgcg
gcggaatattttggcgagggcgacgagtgccacatgaacttccattttccgctcatgccg
aggatgtacatggccctcgagatggaagaccgcttcccgatcatcgacattctcgaccag
acgccggagattcctgaaagcagtcagtgggcgtcgtttctgcgcaaccacgacgaactc
actctcgagatggtcaccgacgaggagcgcgactacatgcgtcgggtctacgctcacgat
ccgaaagcccgcattaacctcggcatccgtcgccgtctcgcgccgctcatgtccaacgac
cggcgcaagatcgagctgatgaacatcatgctgctctcactgccgggcacgccggtgctc
tactacggtgacgagataggcatgggcgacaatttctaccttggcgaccgcgacggcgtg
cgcacgccgatgcagtggaacggcgaccgcaacgccggcttttcccgcgccaatccgcag
caactgcagcttccggtgatcatcgatcccgagtaccattacgaggcgacgaacgtcgag
gtacaggacgccagcattaactcgctgctctggtggacgcggcacatgctttccacatcc
cggcgttacaaggcgctgagccgcggcgacatacggttcatcgactcgcacaacccgcag
attctggtgttcaccagaacctacgagggcgagaccatgctctgcgtgatcaacctgtcg
cgcaacgcccaggccgtcgggatcgacctgtcggaatacgaaggcttcacgccagaggag
gtgttcagttttacccattttccggggatatcctcgcgtccctacaccgtgacgctcggc
ccctacgggtatttctggttccgccttttcaggagcgaggaggaggccggtatgcgccgg
tatgtcgaaaagccgttcgcgaaagccgcttccctggagtcgcttttttcagggcggccg
ctggagcgctttgaaacaagggtgcttcccgagtacattcggggatgccggtggttcggc
ggcaaggcgcgaaagatactgcgcacgaaagtgttggagcgcatacctctcaagggtctc
gaggagacggagtatcttgtcgtcgaagtcagctacgccagcggccagaacgaaacctat
cagttgcctgtcgcgtttattccgctcgaacagttcggcgaggacgaggggccgctgctc
aaacgggtgatatgcatggccaggataggcgaacgcgagggttacctctgcgacgcggct
tatgagaaagcgttccgccgcttcctgctcgacatggtcgtaaggaagagaatcgtcaag
gggacgacgggaaaactcgtggctgaaagaggcgaacgtctcggggaataccttcctgaa
gaggaggatggggtggtttcgtcgcttttcggggccgagcagagcaacacgtcgatcatg
tacggcgacagcctctgcctgaaactctatcgcaagatatcctccggcgcttctcccgaa
atcgaaatctgccgtacgctcacggagaaaaccctctacgccaacgccccagcctacttg
ggggcgatcagtttttcacgaagccgcaaggatcagttcgcgctggggatattgcagaat
ttcatccccaacgaaggcgacgcctggaccgtttcgctgcattacgtgcatcgctactac
gaggaggtgctcgccatgccgcaagccacgacggtcgttcccgaactgccggtcatcggc
gtgaaaacggtcgacatgccggaggtgatgcactcgctgatcggcgaggtctatctcgac
atggtcacgaggctcgccgagaggactgccgggatgcatctggcgctttccgatgcgggg
ctcggtccggatttttctcccgaaccgtttaccaccctctaccagcgctccatataccag
tcgatgagggagcaggtgaaacggggcatggtgctcctgaagggacagttgaaaggaatc
gacgaagagtaccgcgatctggcgcgttccatcatcggctgtgagagcgaaattctcgat
cagctctcgcacatcaagaaccgcaaggtcagcgcgtcgaaaatcaggattcacggcgac
taccatttggggcaggtactgtataccggccttgatttcgtgatcatcgatttcgagggt
gaaccggcccgttcgctcagcgagcgccgtatcaagcgttcggttttccgggatctcgcg
ggtatgatgcgttcgttccattacgcggcgttcaacgtgttgatccaggatcgttcgata
aggcccgaggacgtcgaacggctcgaaccgtgggccgaactctggagtttctataccgga
cagcatttcttcgatgtctacgaggcggccgtccggggcagggggctcgttcccgaacat
gctaccgaacagcacctgcttctgcgcggttatctgatggacaaggccgtctacgagctc
aattacgagctgaacaaccgtcccgaatggatcgggattgcgctcaagggactgcaacgc
ctgctcgcgcagtag

DBGET integrated database retrieval system