KEGG   Prosthecochloris sp. GSB1: CHL67_05395Help
Entry
CHL67_05395       CDS       T04996                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pros  Prosthecochloris sp. GSB1
Brite
Enzymes [BR:pros01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CHL67_05395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ASQ90432
UniProt: A0A222SI71
LinkDB All DBs
Position
complement(1143111..1143716)
Genome map
AA seq 201 aa AA seqDB search
MAYSQPALPYAENALEPCISAKTIGFHYGKHHSTYVKKFNELVSGTPYDDQGIEDVIVAV
ANDPSKAAIFNNGAQAWNHTFYWNSLTPNGGGKPAGPLAEKIDADFGSYDKLRDELANAA
ATQFGSGWAWLVLDKGSLQVVKTSNAMTPLANGAFPLLTLDVWEHAYYLDYQNRRPDYVA
TVLDELLNWKFAESNFDEAQA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcctactcacaacctgcgttaccgtatgcggaaaatgctcttgaaccctgcatctcc
gccaaaaccataggcttccactacggcaagcaccattcgacctatgtcaagaaattcaac
gaactcgtctccggcacgccttatgacgaccagggcatcgaagacgtcatcgtcgccgtc
gccaacgatccttcaaaagcggcgattttcaacaacggcgcccaggcgtggaaccacacc
ttctactggaacagcctcacgcccaacgggggaggcaaaccagcgggaccgctggccgaa
aagatcgacgccgatttcggaagctatgacaaactcagggatgaactcgccaacgccgca
gcgacgcagttcggcagcggatgggcctggctcgtgctggacaagggatcgttgcaggtc
gtcaagacatcgaacgccatgacgccgcttgccaacggcgcgtttccgcttctgacgctc
gacgtgtgggaacatgcctactacctcgactaccagaaccggcgcccggactacgtggcg
acggtgctcgacgagttgctgaactggaaattcgcagagagcaatttcgacgaggcccag
gcgtag

DBGET integrated database retrieval system