KEGG   Proteus sp. CD3: BTA34_08050Help
Entry
BTA34_08050       CDS       T06244                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
prot  Proteus sp. CD3
Brite
KEGG Orthology (KO) [BR:prot00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BTA34_08050
Enzymes [BR:prot01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BTA34_08050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored FAD_binding_3 Thi4 AlaDh_PNT_C DAO NAD_binding_8 K_oxygenase Lycopene_cycl NAD_binding_7 FMO-like Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: QEZ92302
UniProt: A0A5J6RQM5
LinkDB All DBs
Position
complement(1764241..1765806)
Genome map
AA seq 521 aa AA seqDB search
MLDNNLKAQLKAYLERLTQPVELVATLDDSKHSADIQALLKEIEPLSDKVTYREDNNANV
RKPSFLITNPGKETGVRFAGSPLGHEFTSLVLALLQTGGHPSKEAQELLEQIRQLDGEFH
FETYYSLSCHNCPDVVQALNLMAILNPKVTHTAIDGGMFQNEIQERNIMGVPAVFLNGNE
FGQGRMTLAEIVNKVDSNAEKRTAELLNQKDAFDVLIVGSGPAGASAAVYSARKGLNTGL
IGERFGGQVLDTVDIENYISVPKTEGAKLAGALKAHVDDYQVDVIDSQTVSRLIPGASEG
ELHQIETASGAILKTRSLIIATGARWRNMNVPGENEYRTRGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGLVEHVTVLEFAPEMRADAVLQKKLRSLSNVEVILNAQTTEVYGD
GTKLTGLKYKDRTNDSMHDIALAGIFVQIGLLPNTQWLEGTVERNKMGEIVVDARGETNI
KGVFAAGDCTTVPYKQIIIAAGEGAKASLSAFDYLIRTSAK
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagataataatttaaaagctcaattgaaagcttatttagaacgattaacccagcca
gttgagttagtagcaacattagacgacagtaaacattctgctgatatccaagcgctatta
aaagaaatcgaaccattatccgataaagtcacttatcgtgaagataataacgcgaatgta
cgtaaaccatcttttcttattaccaacccagggaaagaaaccggtgttcgttttgctggt
tcgccattaggtcatgaatttacttcattagttttagcattattacaaactggtggacac
ccatcaaaagaagcacaagaattacttgaacaaattcgtcagttagacggtgagtttcat
ttcgaaacctattattcgctctcttgtcataactgccctgatgttgttcaggcattaaac
ttaatggcgattttaaatccgaaggtcacacatactgcgattgacggaggcatgttccaa
aatgaaattcaggaacgtaatattatgggcgttcctgctgtattcttaaatggtaacgag
tttggccagggtcgtatgaccttagctgaaattgttaacaaagtagacagcaatgcagaa
aaacgtaccgcagaattattaaaccaaaaagatgcatttgatgtattaattgtgggaagt
ggtcctgcgggtgcatcagcggcggtttattctgctcgtaaaggtttaaatacaggtctt
atcggtgaacgttttggtggccaagttcttgatactgttgatattgaaaactatatctca
gtaccaaaaactgaaggtgcaaaacttgctggtgcgttaaaagctcacgttgatgattat
caagtggatgtgattgatagccaaacggttagtcgcttaattccgggagcatcagaaggg
gagttacatcaaattgaaacagcatcaggcgcaattttaaaaactcgtagcttaattatt
gcaacaggcgctcgctggagaaatatgaatgttcctggcgaaaatgaataccgcactcgt
ggtgttacttattgtccacactgtgatggtccactgtttaaaggcaaaagagttgctgtt
attggtggtggtaactctggtgttgaagctgcaattgacttagctggcttagttgaacat
gtaacagtgttagaatttgctccagaaatgagagcagatgcggtattacagaaaaaatta
cgtagcttaagcaatgtagaagttatcttaaatgcgcaaactacagaagtatatggcgat
ggcactaagttaaccggtctaaaatataaagatcgtactaatgattctatgcatgatatt
gcattagccggtattttcgttcaaatcggtttattacctaatacacagtggttagaaggt
actgttgaacgtaataaaatgggcgaaattgttgttgatgcccgtggtgaaactaatatc
aaaggtgtgtttgcagccggtgactgtacaacagtaccttataagcaaatcattattgct
gctggcgaaggtgcaaaagcctcacttagcgcctttgattacttaattcgcaccagtgca
aaataa

DBGET integrated database retrieval system