KEGG   Pseudomonas aeruginosa RP73: M062_04670Help
Entry
M062_04670        CDS       T02711                                 

Definition
(GenBank) membrane protein
  KO
K07058  membrane protein
Organism
prp  Pseudomonas aeruginosa RP73
Brite
KEGG Orthology (KO) [BR:prp00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    M062_04670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB AGH
Motif
Other DBs
NCBI-ProteinID: AGO38832
LinkDB All DBs
Position
1000795..1002030
Genome map
AA seq 411 aa AA seqDB search
MREHFNDGVEFARFLAHRFVTDKAPNSAAALTYTTLFAVVPMMTVMFSMLSLIPAFHGMG
ESIQTFIFRNFVPSAGEAVETYLKSFTTQARHLTWVGVVFLAVTAFTMLVTIEKAFNEIW
RVRQPRRGVGRFLLYWAILSLGPLLLGAGFAVTTYITSLSLLHGPDALPGAETLLGLMPL
AFSVAAFTLLYSAVPNARVPVRHALMGGVFTAVLFEAAKTLFGLYVSLFPGYQLIYGAFA
TVPIFLLWIYLSWMIVLFGAVLVCNLSSSRLWRRRSLPKLIVLLGVLRVFLQRQQLGQSL
RLTHLHRAGWLLPEDEWEELLDFLEKEQFVCRAGGGEWVLCRDLGAYSLHRLLNRCPWPM
PSRERMPANLDEAWYPPFQQAMERLQVEQEALFGESLAHWLADGTSGAKVT
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaacatttcaacgatggggtcgagttcgctcgcttcctcgctcatcgcttcgtc
accgacaaggctcccaacagcgcggcggcgctgacctacaccacgttgttcgcggtagtg
ccgatgatgacggtgatgttttccatgctttcgctgattccggcattccatggcatgggc
gagtcgatccagactttcatctttcgcaatttcgtgccttccgctggagaagcggtggaa
acctacctgaagagtttcaccacccaggcccggcacctgacctgggtcggggtggtcttt
ctggcagtcaccgccttcaccatgctggtgaccatcgagaaagccttcaacgagatctgg
cgggttcgccagccacgccgcggtgtcgggcggttcctcctctactgggcgatcctcagc
ctgggcccattgttgctgggggccggcttcgccgtgaccacctacatcacttcgctgtcg
ctgctccatggcccggacgcgttgccgggcgcggagacgctgctggggctgatgccgctg
gcgttcagcgtggcggccttcaccctgctctattcggcggtcccgaacgcccgggtcccg
gtgcgccatgccctgatgggcggcgtgttcacggcggtactgttcgaagccgcgaaaacc
ctgttcgggctgtacgtaagcctgtttcccggctaccagttgatctacggtgccttcgcc
accgtgcctatcttcctgctgtggatctatctttcctggatgatcgttctgttcggcgcg
gtgctggtctgcaatctctcttcttcccgtctctggcggcggcgctcgctgcccaagctg
atcgtcctgctcggcgtgctgagggtgttcctccagcgccagcagcttggacagtcgctg
cgcctgacccacttgcatcgtgcgggttggctgttgcccgaggatgagtgggaggaactg
ctggactttctcgagaaggagcagttcgtctgtcgcgccggcggaggcgagtgggtgctg
tgccgggatcttggcgcctacagtctgcatcgcttgctgaatcgctgcccctggcccatg
cctagccgagagcgcatgcctgcgaatctggacgaggcgtggtatccgccgttccagcag
gccatggagcgcttgcaggtggagcaggaggcgctgttcggagaaagcctggcccactgg
ctggcggacggaacctcgggagcgaaggtgacgtaa

DBGET integrated database retrieval system