KEGG   Pseudomonas aeruginosa RP73: M062_08580Help
Entry
M062_08580        CDS       T02711                                 

Definition
(GenBank) 3-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
prp  Pseudomonas aeruginosa RP73
Pathway
prp00061  Fatty acid biosynthesis
prp01100  Metabolic pathways
prp01212  Fatty acid metabolism
Module
prp_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:prp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    M062_08580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:prp01004]
    M062_08580
Enzymes [BR:prp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     M062_08580
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     M062_08580
Lipid biosynthesis proteins [BR:prp01004]
 Fatty acid synthase
  Component type
   M062_08580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AGO39412
LinkDB All DBs
Structure
PDB: 

Position
complement(1811940..1812455)
Genome map
AA seq 171 aa AA seqDB search
MTKQHAFTREDLLRCSRGELFGPGNAQLPAPNMLMIDRIVHISDVGGKYGKGELVAELDI
NPDLWFFACHFEGDPVMPGCLGLDAMWQLVGFYLGWQGNPGRGRALGSGEVKFFGQVLPT
AKKVTYNIHIKRTINRSLVLAIADGTVSVDGREIYSAEGLRVGLFTSTDSF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacaacacgccttcacccgagaagacctgctgcgctgcagtcgcggcgagctg
ttcggcccgggtaacgcgcaacttcccgcccccaacatgctgatgatcgatcgcatcgtt
cacatcagcgatgtcggcggcaagtatggcaagggcgagctggtcgccgagctggatatc
aacccggacctgtggttcttcgcctgtcacttcgaaggcgatccggtcatgcccggttgc
ctgggcctggatgccatgtggcagctggtcggtttctacctcggctggcagggcaacccc
ggccgcggccgcgccctgggttcgggcgaagtgaagttcttcggtcaggttctgccgaca
gcgaagaaggtcacgtataacattcatatcaagcgcacgatcaatcgttcgctggtcctg
gccatcgccgacggcaccgtcagcgtcgatggccgcgaaatctacagtgccgaaggcctc
cgcgtcggcctgttcacctccactgacagcttctaa

DBGET integrated database retrieval system