KEGG   Pseudomonas aeruginosa RP73: M062_09275Help
Entry
M062_09275        CDS       T02711                                 

Definition
(GenBank) nitrate reductase subunit alpha
  KO
K00372  assimilatory nitrate reductase catalytic subunit [EC:1.7.99.-]
Organism
prp  Pseudomonas aeruginosa RP73
Pathway
prp00910  Nitrogen metabolism
prp01100  Metabolic pathways
prp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:prp00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    M062_09275
Enzymes [BR:prp01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     M062_09275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding Molybdop_Fe4S4 Fer2_BFD
Motif
Other DBs
NCBI-ProteinID: AGO39541
LinkDB All DBs
Position
complement(1955178..1957904)
Genome map
AA seq 908 aa AA seqDB search
MSTDSPLRTTASTCCYCGVGCGVLIEHDGERILGVQGDPRHPANFGRLCSKGASLHLTGD
LQARALYPQLRLGKQLARARSDWESALEHAAGRFAETIREHGPDSVAFYISGQLLTEDYY
AFNKLARALVGTNNIDSNSRLCMSSAVVGYKRSLGADAPPCSYEDLDCADCVLIAGSNMA
FAHPVLFRRLEAAKAARPEMRIVVIDPRRTDTCELADLHLALLPGTDVALFHGILHILLW
EDWIDRSFIAEHTEGFADLKELVRDYTPAAVADICGIDRADLQRCAEWIGRSPRFLSLWC
MGLNQSSAGSAKNSALINLHLATGKIGRAGCGPFSLTGQPNAMGGRETGSLANLLPGHRE
AADPGHRAEVAHYWGVEQLPTSPGLSAIELFDAVHDGRIKALWIACTNPAQSLPDQRKIH
EALARCPFVVVQEAFAGTETCQYADLLLPAASWGEKEGSVTNSERRISHVRRAVPPPGEA
RQDWNIVCDFARRLEGHLRPAKPGLFAFADSRSLFDEYKLLTAGRDLDLSGLSYALLDRL
GPQQWPFPTGAEQGTARLYADGRFPTASGRAQLVAEPYRAAQEKRDARYPLTLNTGRLRD
QWHGMSRTGTCARLFGHEEEALVHLHPEELRRRQLQDGQLVRLKSRRGALILPVSADDSV
RPGQAFLPMHWGDRFLKGLGCNVLTLPAFDPLSKQPELKHAGVQVESVELPWRLFALVET
DIQARFEALRALCEVFDHASFSLAGRERPALLVSAAHHEAPGADLLERIDRQLELLDGPI
LAYDDPRRAIGKRVRLEDGRIVAVRLAGETLARDWLKELWLTGRADSELRRWLLAPLGAA
PGRPSQGAGGKTLCSCQNVSQQTVLGGIARGLDLDGLKREFGCGTGCGSCVPEIKRLLAA
PRPMAANA
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacagattccccgctgcgcaccaccgcttcgacctgctgctactgcggcgtgggt
tgtggcgtcctgatcgaacacgacggcgaacgcatcctcggcgtgcaaggcgatcctcgg
cacccggccaacttcggcagactctgcagcaaaggcgccagcctgcacctgaccggcgac
ctccaggcccgcgcgctgtacccccaactgcgcctcggcaagcaactggcgcgggctcgc
agcgactgggagagtgccctggaacatgccgccgggcgtttcgccgagaccattcgcgaa
cacgggccggacagcgtggccttctatatctccggccagttgctgaccgaggactactac
gccttcaacaagctggcgcgggccctggtcggcaccaacaacatcgacagcaattcgcgc
ctgtgcatgtcctcggcggtggtcggctacaagcgcagcctgggcgccgacgcaccgccg
tgcagctacgaagacctcgactgcgccgattgcgtgctgatcgccggcagcaacatggcc
ttcgcccacccggtcctgttccgtcgcctggaagccgccaaggccgctcggccggagatg
cgcatcgtggtgatcgacccgcggcgcaccgacacctgcgagctggccgacctgcacctg
gcgctgctgcccggtaccgacgtcgcactgttccacggcatcctgcatatcctgctctgg
gaggactggatcgaccgttcgttcatcgccgagcataccgagggtttcgccgacctgaag
gaactggtgcgcgactacaccccggccgccgtcgccgacatctgcggcatcgaccgcgcc
gacctgcagcgctgcgccgaatggatcggccgttcgccgcgcttcctttcgctctggtgc
atggggctcaaccagtccagcgccggcagcgccaagaacagcgcactgatcaacctgcac
ctggccaccggcaagatcggccgcgccggatgcgggccgttttccctcaccggtcagccg
aacgccatgggcggtcgcgagaccggcagcctggccaacctgctgcccggccaccgcgaa
gccgccgatcccggccatcgcgccgaagtggcgcactactggggtgtggaacagttgccc
acgtcccccggtctcagcgccatcgagctgttcgatgcggtccacgacggccggatcaag
gcgctctggatcgcctgtaccaaccccgcgcaatcgctgccggaccagcgcaagatccac
gaggcccttgcccgctgtcccttcgtggtggtccaggaagccttcgccggcacggaaacc
tgccaatacgccgaccttttgcttccagccgcatcctggggagaaaaggaaggctccgtg
accaattcggaacggcggatcagtcatgtccgtcgggccgttccgccccccggtgaagcg
cgccaggactggaacatcgtctgcgacttcgcgcgccgcctggaagggcacctgcgtccc
gctaaacccggcctgttcgcctttgccgacagccgcagcctgttcgacgaatacaagctg
cttaccgccggccgcgacctcgatctttccggcctcagctacgcactgctcgaccgcctg
gggccgcagcaatggccatttcccactggcgcggagcaaggcaccgcacggctctatgca
gacggccgcttccctaccgcctcgggacgcgcgcaactggtcgccgaaccctaccgcgcc
gcccaggaaaaacgtgacgcgcgctacccgctgaccctcaataccggacgcttgcgcgac
cagtggcacggcatgagccggaccggcacctgcgcacgcctgttcggccatgaagaggag
gccctggtgcacctgcatcccgaggaactgcgccgccgccaactgcaggacgggcagctc
gtgcgcctgaagagccggcgtggcgccctgatcctgccagtgagtgcagacgactcggtg
cgccccggccaggccttcctgccgatgcactggggcgatcgcttcctcaagggcctgggc
tgcaatgtcctgaccctgccggcgttcgaccccctgtcgaaacaacccgaactcaagcac
gccggggttcaggtcgaatccgtcgaactgccctggcgcctgttcgcgctggtggaaacc
gatatccaggcgcgtttcgaggccctccgtgcgctgtgcgaagtcttcgaccacgccagc
ttcagtctcgccggacgcgagcgccccgccctgctggtcagcgccgcacaccatgaggca
cctggcgcagacctgctggagcggatagatcgccaactcgaattgctcgacgggccgatc
ctcgcctacgacgacccacggcgcgccatcggcaagcgcgtgcgcctcgaagacgggcgc
atcgtcgccgtccggctcgccggcgaaaccctcgcccgcgactggttgaaagaactctgg
cttaccggccgggccgatagcgagctacgccgctggctgctcgcgccactcggcgcggca
ccgggacgccccagccagggtgcgggcggcaagaccctgtgcagttgccagaacgtcagc
cagcaaacggtgctcggcggcatcgcccgcggattggacctggacggattgaagcgcgag
ttcggctgcggcaccggctgcggctcctgcgtaccggaaatcaagagactgctggcggcc
ccccggcccatggcggcgaatgcctga

DBGET integrated database retrieval system