KEGG   Pseudomonas aeruginosa RP73: M062_12650Help
Entry
M062_12650        CDS       T02711                                 

Definition
(GenBank) peptide synthase
Organism
prp  Pseudomonas aeruginosa RP73
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AGO43413
LinkDB All DBs
Position
complement(2752636..2765664)
Genome map
AA seq 4342 aa AA seqDB search
MMDAFELPTTLVQALRRRAVQEPERLALRFLAEDDGEGVVLSYRDLDLRARSIAAALQAH
AQLGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESARRHHQERLLSIIADAEPRLV
LTTADLREPLLQMNAQLSAANAPQLLCVDQLDPAVAEAWDEPQVRPEHIAFLQYTSGSTA
LPKGVQVSHGNLVANEVLIRRGFGIGADDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVLM
SPRYFLERPVRWLEAISQYGGTVSGGPDFAYRLCSERVAESALQRLDLSGWRVAFSGSEP
IRQDSLERFAEKFAASRFDASSFFACYGLAEATLFVTGGQRGQGIPALAVDGEALARNRI
AEGEGSVLMCCGRSQPEHAVLIVDAASGEVLGDDNVGEIWAAGPSIAHGYWRNPEASAKT
FVERDGRTWLRTGDLGFLRDGELFVTGRLKDMLIVRGHNLYPQDIERTVESEVPSARKGR
VAAFAVTVDGEEGIGIAAEIGRGVQKSVPAQELIDSIRQAVAEAYQEAPKVVALLNPGAL
PKTSSGKLQRSACRLRLEDGSLDSYALFPGLQAVQEAQPPAGDDELLARIGEIWKARLGV
AQVAPRDHFFLLGGNSIGAAQVVAQVRDSLGVALDLRQLFEAPTLQAFSATVARQLAAGL
PAEAPMAHLPRGVDLPQSAAQQRLWLTWQIDPQSAAYNIPGGLRLRGELDEAALRASFQR
LVERHEALRTRFLERDGAALQRIDERGEFAWQFVDLAALAEHERAAAAAQRREAEAQQPF
DLEKGPLLRVSLVRLDEQEHQLWVTLHHIVADGWSLNLLLDEFSRLYAEACGGQPADLAP
LELHYAEFAAWQRQWLDAGEGARQLAYWRERLGDTAPVLELATDHPRTARQASPAARYSL
RVDEALARAIREAALDHEASVFMWLLAAFQALLHRHSGQGEIRIGVPSANRQRLETQGLV
GFFINTLVLRGTPRARQPFAALLGEAREATLGAQANQDLPFDQVLAACGQGGQLFQVLFN
HQQRDLSALRRLPGLLADELPWHSREAKFDLQLQSEEDARGRLTLNFDYAADLFDEASIR
RFAAQYLELLRQVAEDPQRCLGDIALVDAEQAAHLAEWGSAPCEPARAWLPELLERQLAQ
SAERVALEWDGGSLGYAELHARANRLAHYLRDKGVGPDVRVAICAERSPQLLVGLLAIVK
AGGAYVPLDPDYPSERLAYMLADSGVELLLTQAHLFERLPGAEGVTPICLDSLKLDNWPS
QAPGLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQATYALDGDDVLMQKAPV
SFDVSVWECFWPLVTGCRLVLAAPGEHRDPARLVELVRQFEVTTLHFVPPLLQLFIDEPG
VAACGSLRRLFSGGEALPAELRNRVLQRLPAVALHNRYGPTETAINVTHWQCRAEDGERS
PIGRPLGNVVCRVLDAEFNLLPAGVAGELCIGGLGLARGYLGRPALSAERFVADPFSAAG
ERLYRTGDRARWNADGVLEYLGRLDQQVKLRGFRIEPEEIQARLLAQPGVAQAVVVIREG
VAGSQLVGYYTGAVGAEAEAEQNQRLRAALQAELPEYMVPTQLMRLAQMPLGPSGKLDTR
ALPEPVWQQREHVEPRTELQRRIAAIWSEVLGLPRVGLRDDFFELGGHSLLATRIVSRTR
QACDVELPLRALFEASELEAFCEQVRAAQAAGRTDSHGAIRRIDREQPVPLSYSQQRMWF
LWQLEPDSPAYNVGGLARLSGPLDVARFEAALQALVQRHETLRTTFPSVDGVPVQRVHGD
GGLHMDWQDFSALDRDSRQQHLQTLADSEAHRPFDLESGPLLRVCMVKMAEREHYLVVTL
HHIVTEGWAMDIFARELGALYEAFLDDRESPLEPLPVQYLDYSVWQREWLESGERQRQLD
YWKAQLGNEHPLLELPGDRPRPPVQSHQGDLYRFDLSPELAERVRRFNAARGLTMFMTMT
ATLAALLYRYSGQQDLRIGAPVANRIRPESEGLIGAFLNTQVLRCRLDGQMSVGELLEQV
RQTVIDGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQTRQLAGMTVEYIA
NDARATKFDLNLEVTDLDQRLGCCLTYSRDLFDEPRIARMAGHWQNLLEALLGDPQRRIA
ELPLFAAEERKQLLLAGTAGEAGLQDTLHGLFAARVAASPQAPALTFAGQTLSYAELDAR
SNRLARVLRSHGVGPEVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLERLQYMIE
DSGVRLLLSHAALFEALGELPAGVARWCLEEDGPALDAEDPAPLAALSGPQHQAYLIYTS
GSTGKPKGVAVSHGEIAMHCAAVIERFGMRAEDCELHFYSINFDAASERLLAPLLCGARV
VLRAQGQWGAEEICELIRAEGVSILGFTPSYGSQLAQWLESQGRQLPVRMCITGGEALTG
EHLQRIRQAFAPASFFNAYGPTETVVMPLACLAPERLEEGAASVPIGSVVGARVAYILDA
DLALVPQGATGELYVGGAGLARGYHERPALSAERFVPDPFAAEGGRLYRTGDLVRLCDNG
QVEYVGRIDHQVKIRGFRIELGEIEARLLEHPQVREALVLALDSPSGKQLAGYVASAVAE
QDEDAQAALREALKTHLKQQLPDYMVPAHLLLLASLPLTDNGKLDRRALPAPDPALNLQA
YEAPRSVLEQQLAGVWREVLNVERVGLGDNFFELGGDSILSIQVVSRARQLGIHFSPRDL
FQHQTVQSLAAVARHSQASQAEQGPVQGDSALTPIQHWFFDLPLARREHWNQSLLLQPRQ
AIDLGLLRKSLQRLVEQHDALRLAFRQVDGEWLAQHRPLHEQELLWHVPVQSFDECAELF
AKAQRSLDLEQGPLLRAVLVDGPAGEQRLLLAIHHLVVDGVSWRVLLEDLQQVYRQLDEG
AEPALPAKTSAFRDWAGRLQAYAGSESLREELGWWQARLGGQSAEWPCDRPRGDNREALA
ESVSLRLDPQRTRQLLQQAPAAYRTQVNDLLLTALARVLCRWSGQPSTLVQLEGHGREAL
FDDIDLTRSVGWFTSAYPLRLTPAQSPGESIKAIKEQLRAVPHKGLGYGVLRYLADPAVR
QAMAALPTAPITFNYLGQFDQSFADALFQPLDQPTGPIHDEQAPLPNELSVDGQVYGGEL
VLRWTYSRERYDARTVNELAQAYLAELQALIEHCLEDGAGGLTPSDFPLAQLSQAQLDAL
AVPAGEIEDVYPLTPMQEGLLLHTLLEPGTGIYYMQDRYRIDSPLDPERFAAAWQAVVAR
HEALRASFVWNAGETMLQVIHKPGRTRIEFLDWSELPEDGHEERLQALHKREREAGFDLL
EQPPFHLRLIRLGEARYWFMMSNHHILIDAWCRGLLMNDFFEIYSALGESRPANLPTPPR
YRDYIAWLQRQDLEQSRRWWSESLRGFERPTLVPSDRPFLREHAGESGGMIVGDRYTRLD
AADGARLRELAQRYQLTVNTFAQAAWALTLRRFSGERDVLFGVTVAGRPVGMPEMQRTVG
LFINSIPLRVQMPAAGQRCTVREWLNRLFERNLELREHEHLPLVAIQESSELPKGQPLFD
SLFVFENAPVEVSVLDRAQSLNASSDSGRTHTNFPLTVVCYPGDDLVLHLSYDQRYFEAP
TVERLLGEFKRLLLALADGFHGELEALPLLGEDERDFLLDGCNRSARDYPLEQGYVRLFE
AQVAAHPQRIAASCLEQRWSYAELNRRANRLGHALRAAGVGIDQPVALLAERGLDLLGMI
VGSFKAGAGYLPLDPGHPTQRLTRIVELSRTPVLVCTQACREQALALFDELGCVDRPRLL
VWDEIQQGEGAEHDPQVYSGPQNLAYVIYTSGSTGLPKGVMVEQAGMLNNQLSKVPYLEL
DENDVIAQTASQSFDISVWQFLAAPLFGARVAIVPNAVAHDPQGLLAHVGEQGITVLESV
PSLIQGMLAEERQALDGLRWMLPTGEAMPPELARQWLKRYPRIGLVNAYGPAECSDDVAF
FRVDLASTESTYLPIGSPTDNNRLYLLGAGADDAFELVPLGAVGELCVAGTGVGRGYVGD
PLRTAQAFVPHPFGAPGERLYRTGDLARRRADGVLEYVGRIDHQVKIRGFRIELGEIEAR
LHERADVREAAVAVQEGENGKYLVGYLVPGETPRSSADSPAGLVVEQGAWFERIKQQLRA
DLPDYMVPLHWLVLDRMPLNANGKLDRKALPALDIGQMQNQAYQAPRNELEETLARIWAE
VLKVERVGVFDNFFELGGHSLLATQIASRVQKALQRNVPLRAMFECTTVEELASYIESLA
PSEISEQKAERLNDLMSKLEML
NT seq 13029 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgccttcgaacttcccaccaccctggtccaggccctgcgtcgccgcgctgtc
caggagcccgagcgcctggcgctgcgcttcctcgccgaggacgatggcgaaggcgtggtc
ctcagctatcgcgatctcgacctgcgcgcgcggagcatcgccgcggccctgcaggcccat
gcgcagctgggcgatcgcgcggtactgctgtttcccagcggccccgactacgtcgcggcg
ttcttcggttgcctgtatgccggggtcatcgcggtgccggcctacccgccggaatcggcg
cgccgccatcaccaggaacgcctgttgtcgatcatcgccgacgccgagccgcgcctggtc
ctgaccaccgctgacctgcgcgagccattgctgcagatgaacgcgcaactgtccgccgcc
aacgccccgcaactgctctgcgtcgaccagttggacccggccgttgccgaggcctgggac
gagccgcaagtgcgtcccgagcacatcgccttcctccagtacacctccggttcaaccgca
ttgcccaagggcgtgcaggtcagccatggcaacctggtcgccaacgaggtgctgatccgc
cgaggcttcggcatcggtgccgacgacgtgatcgtcagctggctgccgctgtaccacgac
atgggcctgatcggcggcctgctgcaaccgatcttcagcggcgtaccctgcgtgctgatg
tcgccgcgctacttcctcgaacgtccggtgcgctggctggaagccatcagccagtacggc
ggcaccgtcagcggcggtcccgatttcgcctaccggctgtgcagcgagcgggtcgccgag
tcggccctgcagcgtctcgacctgagcggttggcgggtagccttctccggttccgagccg
atccgccaggacagcctggaacgcttcgccgagaaattcgccgccagccgcttcgatgcg
tccagtttcttcgcctgctacggcctcgccgaggcgaccctgttcgtcaccggcggccag
cgcggccagggcattcccgccctggcggtggatggcgaggcgctggcgcgcaaccgcatc
gccgaaggcgaaggcagcgtgctgatgtgctgcggccgcagccagccggaacacgccgtg
ctgatcgtcgacgcggcgagcggcgaggtcctcggcgacgacaacgtcggcgagatctgg
gccgccgggccgagcatcgcccacggctactggcgcaacccggaagcttcggcgaagacc
ttcgtcgagcgtgacgggcgcacctggctgcgcaccggcgacctcggcttcctccgcgac
ggcgaactgttcgtcaccgggcgcctgaaggacatgctcatcgtccgcggccacaacctc
tatccgcaggacatcgaacgcaccgtcgagagcgaggtgccgtcggcgcgcaagggcagg
gtcgcggccttcgcggtcacggtcgatggcgaggaaggcatcggcatcgccgccgagatc
ggtcgcggcgtccagaaatcggtgccggcccaggagctgatcgactcgatccgccaggcg
gtggccgaggcctaccaggaagcgccgaaggtggtggcgctgctcaatcccggcgccttg
ccgaagacgtccagcggcaagctgcaacgttccgcctgccgcctgcgcctggaagacggc
agcctggacagctatgcgctgtttcccggcctccaggccgtgcaggaggcgcagccgccg
gcaggcgacgacgaactgctggcacgcatcggcgagatctggaaggcccggctgggcgtg
gcgcaggtagcgccgcgcgatcacttcttcctgcttggcggcaattccatcggcgccgcc
caggtggtcgcccaggtgcgcgacagtctcggcgtcgccctcgacctgcgccaactgttc
gaggcgccgaccctgcaggccttcagcgccacggtggcccgccaactggccgccggcctg
ccggccgaggcaccgatggcgcacctgccgcgcggtgtcgacctgccgcagtcggcggcg
cagcagcgtctctggctgacctggcagatcgatccgcagagcgccgcctacaacatcccc
ggcggcctgcgcctgcgcggcgagctggacgaagcggcgctgcgcgccagcttccagcgc
ctggtcgaacgccacgaagcgctgcgcacgcgtttcctcgagcgcgacggcgcggccttg
cagcgtatcgacgagcggggcgagttcgcctggcagttcgtcgacctcgccgcgctggcc
gagcacgaacgcgccgcggctgccgcgcagcgccgcgaagccgaggcgcagcagccgttc
gacctggaaaaggggccgctgctgcgggtcagcctggtgcgcctggacgaacaggagcac
cagctctgggtcaccctgcatcacatcgtcgccgatggttggtcgctgaacctgctgctc
gacgaattctcgcggctctacgccgaagcctgcggcggccagccggccgacttggcgccg
ctggaactgcactacgccgagttcgctgcctggcaacggcagtggctggacgcgggcgag
ggcgcccgccaactggcctactggcgggagcgcctgggcgacacggcgccggtgctggaa
ctggccaccgaccatccgcgcacggcgcgccaggcgtcgcccgccgcgcgctacagcctg
cgggtcgacgaagccctggcgcgggctatccgcgaggccgcgctggaccatgaggcgagt
gtcttcatgtggctgctggcggcgttccaggcgctgctgcatcgccacagcgggcagggc
gagatccgcatcggcgtgcccagcgccaaccgccagcgcctggagacccaggggctggtc
ggcttcttcatcaacaccctggtcctgcgcggcacgccccgggcgcgccagccgttcgcc
gcgttgctcggcgaggctcgcgaggcgaccctcggcgcccaggccaaccaggacctgccg
ttcgaccaggtgctcgcagcctgcggccagggcggccagttgttccaggtgctgttcaac
caccagcagcgcgacctgtcggcgttgcgccggctgcccggcctgctcgccgacgagctg
ccctggcacagccgcgaagccaagttcgacctgcaactgcagagcgaggaggacgctcgc
ggtcgcctgaccctgaatttcgactacgccgcggacctcttcgacgaggccagcatccgg
cgtttcgccgcgcaatacctggagctgctgcgccaggtcgcggaagacccgcagcgctgc
ctcggcgatatcgccctggtcgacgccgagcaggcggcgcacctcgccgaatggggcagc
gcgccctgcgagccggcgcgcgcctggctgccggagctgctggagcggcaactggcgcag
tccgccgaacgcgtcgccctggagtgggacggcggcagcctcggctacgccgaactgcac
gcccgggccaaccgcctggcccactacctgcgcgacaagggcgtcggcccggacgtgcgg
gtagcgatctgcgccgagcgttcgccgcaactgctggtcggtctgctggcgatcgtcaag
gcgggcggcgcctacgtgccgctggacccggactaccccagcgaacgcctggcctacatg
ctcgccgacagtggcgtcgagctgctgctgacccaggcccatctgttcgagcgcctgcct
ggcgcggagggcgtcacgccgatctgcctggacagcctcaagctcgacaactggccgagc
caggcaccgggcctgcacctgcacggcgacaatctcgcctacgtcatctacacctccggc
tccaccggccagccgaagggcgtgggcaacacccacgcggcgctggccgagcgcctgcaa
tggatgcaggccacctacgccctcgacggcgacgacgtgctgatgcagaaggcgccggtg
agcttcgacgtgtcggtgtgggagtgcttctggccgctggtcaccggttgccggttggtc
ctcgccgcccccggcgagcaccgcgatccggcgcgcctggtggaactggtgcggcagttc
gaggtgaccacgctgcacttcgtgccgccgctgctgcaactgttcatcgacgaacccggc
gtcgccgcctgcggcagcctgcgccgcctgttctccggcggcgaggcgcttccggcggag
ctgcgcaaccgcgtgttgcaacgcctgccggcggtggccctgcataaccgctacgggccg
accgagaccgccatcaacgtcacccattggcagtgccgcgcggaagacggcgagcgttcg
ccgatcggccgaccgctgggcaacgtggtctgccgcgtgctggacgccgagttcaacctg
ctgccggccggcgtcgccggcgagctgtgcatcggcggcctgggcctggcccgcggctac
ctggggcgcccggcgctgagcgccgagcgcttcgtcgccgatccgttctcggccgccggc
gagcgcctgtaccgcaccggcgaccgcgcgcgctggaacgccgacggcgtgctggaatac
ctcggccgcctcgaccagcaggtcaagctgcgtggcttccgcatcgagccggaggaaatc
caggcacgcctgctggcgcagccgggggtggcccaggcggtagtggtgatccgcgaaggc
gtggccggcagccagttggtcggctactacaccggcgctgtcggcgccgaggcggaagcc
gagcagaaccagcgtctgcgcgccgcgctacaggccgaactgccggaatacatggtcccg
acgcagttgatgcgcctggcgcagatgcccctcggcccgagcggcaagctggatacgcgg
gcgctgccggagccggtctggcagcagcgcgagcacgtcgagccgcggaccgagctgcaa
cggcgcatcgccgcgatctggagcgaagtgctcggcctgccgcgggtcggcctgcgcgac
gatttcttcgagctcggcgggcattccctgctggccacccgcatcgtctcgcgcacccgc
caggcctgcgacgtcgaactgccgttgcgcgcgctgttcgaggccagcgaactggaggcc
ttctgcgaacaggtccgcgcagcccaggccgccggacgtaccgacagccacggcgcgatc
cgccgcatcgaccgcgagcagccggtgccgctatcctactcgcagcagcgcatgtggttc
ctctggcaactggagccggacagcccggcctacaacgtcggcggcctggcacgcctgagc
gggccgctggacgtggcgcgcttcgaggccgcgctacaggccctggtgcagcgccacgag
accctgcgcaccacgttccccagcgtcgacggcgtgccggtacagcgcgtgcacggcgat
ggcggcctgcacatggactggcaggacttctccgcgctcgaccgcgacagccgccagcag
cacctgcagaccctcgccgacagcgaggcgcaccggcccttcgaccttgagagcgggccg
ttgctgcgggtctgcatggtgaagatggccgagcgcgagcactacctggtggtgaccctg
caccacatcgtcaccgaaggctgggcgatggacatcttcgcccgcgaactgggcgcgctc
tacgaggccttcctcgacgaccgcgaatcgccgctggagccgttgccggtccagtacctg
gactacagcgtgtggcagcgcgagtggctggagagcggcgagcgccagcgccagctcgac
tactggaaggcccagctgggcaacgagcatccgctgctcgaactgccgggcgaccggcca
cgcccgccggtgcagagccaccagggcgacctctaccgcttcgacctgagccccgagctg
gccgagcgcgtgcggcgcttcaacgccgcccgcgggctgaccatgttcatgaccatgacc
gccacccttgcggccttgctctaccgctacagcggccagcaggacctgcgtatcggcgcg
ccggtggcgaaccgcatccgcccggagagcgaagggctgatcggcgccttcctcaatacc
caggtgctgcgctgccggctcgacggacagatgagcgtcggcgagctgctggagcaggtg
cggcagaccgtgatcgatggccagtcgcaccaggacctgccgttcgaccacctggtggaa
gccctgcaaccgccgcgcagcgccgcctacaacccgttgttccaggtgatgtgcaacgtc
cagcgctgggagttccagcagacccggcaactggccgggatgaccgtcgagtacatcgcc
aacgatgcgcgggcgaccaagttcgacctcaacctggaggtcaccgacctcgaccagcgc
ctcggctgctgcctgacctacagccgcgacctgttcgacgaaccgcgcatcgcgcgaatg
gccggacactggcagaacctgctggaggcgctgctgggcgacccgcagcggcgcattgcc
gaattgccgctgttcgccgccgaggagcggaagcaactgctgctcgccggcacggccggc
gaggcagggctccaggacaccctccatggcctgttcgccgcccgcgtggcggccagcccc
caggccccggcgctgaccttcgccggacagaccctgagctatgccgaactcgacgcccgc
tccaaccgtctggcgcgcgtcctgcgcagtcacggcgtcggcccggaagtgcgggtcggc
ctggccctggagcgttcgctggagatggtcgtcggcctgctggcgatcctcaaggccggc
ggcgcctacgtgccgctggacccggaatatccgctggagcgcctgcaatacatgatcgag
gacagcggcgtacgcctgctgctcagccacgcggcgctgttcgaggccctcggcgagctg
ccggcaggcgtggcgcgctggtgcctcgaggaggacggcccggcgctggacgccgaggac
cccgcgccgctggcagcactgagcgggccgcagcaccaggcctacctgatctatacctcc
ggctccaccggcaagccgaagggcgtggcggtctcccacggcgagatcgccatgcactgc
gccgcggtgatcgagcgcttcggcatgcgcgccgaggattgcgaactgcacttctattcg
atcaacttcgacgccgccagcgagcgcctgctggccccgttgctgtgcggcgcccgcgtg
gtgctgcgggcccagggccagtggggcgcggaggaaatctgcgagctgatccgcgcggag
ggcgtgagcatcctcggcttcaccccgagctacggcagccagctcgcccagtggctggag
agccagggccggcagttgccggtgcgcatgtgcatcaccggcggcgaagcgctgaccggc
gagcacctgcaacggattcgccaggccttcgccccggcgtcgttcttcaatgcctacgga
ccgaccgagacggtggtcatgccgctggcctgcctggctcccgaacgactggaggagggt
gccgccagcgtgccgatcggcagcgtggtcggcgcgcgggtcgcctacatcctggatgcc
gacctggccctggtgccgcagggcgcgaccggcgaactctacgtcggcggcgccggcctg
gcgcgcggctaccatgagcgtccggcgctcagcgccgagcgcttcgtgcccgatcccttc
gctgccgagggcggccgcctgtaccgcaccggcgacctggtgcgcctgtgcgacaacggc
caggtggaatatgttggccgcatcgaccaccaggtgaagatccgtggcttccgcatcgaa
ctgggcgagatcgaggcgcgcctgctggagcatccgcaggttcgcgaagcgctggtcctg
gcgctcgacagcccgagcggcaagcagttggccggttatgtcgccagcgcggtggccgag
caggacgaggacgcccaggcggcgctgcgcgaggcgctgaaaacgcatctcaagcagcaa
ttgccggactacatggtgccggcccacctgctgttgctagccagcctgccgctgaccgac
aacggcaagctcgaccgccgcgcgctgccggcgcccgacccggcgctcaacctgcaggcc
tacgaggccccgcgcagcgtgctggagcagcaactggccggggtctggcgcgaggtgctg
aacgtcgagcgggtaggtctcggcgacaacttcttcgaactgggcggcgattcgatcctg
tcgatccaggtggtcagccgcgcccgccagctcggcatccacttcagcccccgcgacctg
ttccagcaccagaccgtgcagagcctcgccgcggtggcccggcacagccaggccagccag
gccgagcaggggccggtgcagggcgacagcgcgctgacgccgatccagcactggttcttc
gacctgccgctggcgcgccgcgaacactggaaccagtcgctgctgttgcagccgcggcag
gccattgacctcggtctgctgcgcaagtccctgcaacgcctggtcgaacagcatgatgcc
ctgcgcctggcgttccgccaggtcgacggcgagtggctggcgcagcatcgtccgctgcac
gaacaggaactgctctggcacgttccggtgcaatccttcgacgaatgcgccgagctgttc
gccaaggcccagcgcagcctcgacctcgaacaggggccgctgctgcgcgcggtgctggtg
gacggcccggccggcgagcaacgcctgctgctggcgatccaccacctggtggtggacggg
gtgtcctggcgggtgctgctggaggatctgcaacaggtctaccgtcagctcgacgagggc
gccgaaccggcgctgccggccaagaccagcgccttccgcgactgggccggacgcctgcag
gcctacgccggcagcgaatcgctgcgcgaggagctgggctggtggcaagcccggctgggc
gggcagtcggccgagtggccatgcgaccgcccgcggggcgacaaccgcgaggcgctggcg
gaaagtgtcagcctgcggctcgacccgcaacgtacccggcaattgctgcaacaggcgccg
gcggcctaccgcacccaggtcaacgacctgctgctgaccgccctcgctcgcgtgctctgc
cgctggagcgggcagccgtcgacgctggtgcagttggaagggcatggccgcgaggcgctg
ttcgacgatatcgacctgacccgcagcgtcggctggttcaccagcgcctacccgttgcgc
ctgaccccggcgcagagcccgggcgagtcgatcaaggcgatcaaggaacagctccgcgcg
gtgccgcacaaaggcctcggctacggcgtgctgcgctacctcgccgatccggcggtgcgc
caggcgatggccgcgctgcccacggcgccgatcaccttcaactacctcggacagttcgac
cagagcttcgccgacgccctgttccagccgctggaccagcccaccgggccgatccacgac
gagcaggcgccgttgcccaacgagctgagcgtcgatggccaggtctacggcggcgagctg
gtgctgcgctggacctacagccgcgagcgctacgacgcgcggacggtgaacgagctggcg
caggcctatctcgccgaactgcaggcgctgatcgagcattgcctggaagacggcgccggc
ggcctgaccccgtccgacttcccgctggcgcaactgagccaggcgcaactggacgccttg
gcggtgccggccggcgagatcgaggacgtctatccgctgaccccgatgcaggaagggttg
ctgttgcacaccctgctggaaccgggcaccggcatctactacatgcaggaccgctaccgg
atcgacagcccgctcgatcccgagcgcttcgctgccgcctggcaggcggtggtggcccgc
cacgaggcgctgcgcgcgtcgttcgtctggaatgccggcgaaacgatgttgcaggtgatc
cacaagcccggtcgcacccgcatcgagttcctcgactggagcgaactgccggaggacggc
cacgaggaacgcctgcaagcgctgcacaagcgcgagcgcgaggccggcttcgacctgctc
gaacagccgccgttccacctgcgcctgatccgcctgggcgaggcgcgctactggttcatg
atgagcaaccaccacatcctcatagatgcctggtgccgtggcctgctgatgaacgacttc
ttcgagatctacagtgctctcggcgaaagccgcccggcgaacctgccgacgccgccgcgc
taccgcgactacatcgcctggctgcaacgccaggacctggagcaatcgcgacgctggtgg
agcgagagcctgcgcggcttcgagcggccgaccctggtgcccagcgaccgcccgttcctc
cgcgagcacgccggcgagagcggcgggatgatcgtcggcgaccgctacacgcgtctggac
gccgccgacggcgcgcgcctgcgcgaactggcgcagcgctaccagctcaccgtcaacacc
ttcgcccaggccgcctgggcgctgaccctgcgccgcttcagcggcgagcgcgacgtgctg
ttcggcgtcaccgtggccgggcgtccggtgggcatgccggaaatgcagcgcaccgtcggc
ctgttcatcaacagcatcccattgcgcgtgcagatgccggccgccggccagcgctgcacg
gtgcgcgaatggctgaaccggctgttcgagcgcaacctggagttgcgcgagcacgagcac
ctgcccctggtggccatccaggaaagcagcgagctgcccaagggccagccgctgttcgac
agcctgttcgtgttcgagaacgccccggtggaagtctcggtgctggaccgcgcgcagagc
ctgaacgccagttccgactccgggcgtacccacaccaacttcccgttgaccgtggtctgc
tatccgggcgatgacctcgtcctgcacctgtcctacgaccagcgctacttcgaggcgccg
accgtcgagcgcctgctcggcgagttcaagcgcctgctgctggccctggccgacggtttc
cacggcgaactggaggccttgccgctgctcggcgaggacgagcgcgacttcctcctcgac
ggctgcaaccgcagcgcccgtgactacccgctggagcaaggctacgtgcggctgttcgag
gcgcaggtggcagcccatccgcagcgcatcgccgccagttgcctggaacagcgctggagc
tacgccgagctgaaccgccgggccaaccgcctcggccacgccctgcgcgccgccggcgtc
ggcatcgaccagccggtggcactgctggccgagcgcggcctcgacctgctcggcatgatc
gtcggcagcttcaaggccggtgccggctacctgccgctcgaccccggccatccgacccag
cgcctgacccggatcgtcgagctgagccgcacgccggtgctggtctgcacccaggcctgc
cgcgagcaggcgctggcgctgttcgacgaactcggctgcgtcgaccggccgcgcctgctg
gtgtgggacgagatccagcagggcgagggcgccgagcacgatccgcaggtctacagcggg
ccgcagaacctcgcctacgtgatctacacctccggctccaccggactgccgaagggcgtg
atggtggagcaggcgggcatgctcaacaaccagttgagcaaggtcccgtacctggaactg
gacgagaacgacgtgatcgcccagaccgcctcgcagagcttcgacatctcggtctggcag
ttcctcgccgcgccgttgttcggcgcccgcgtggcgatcgtgccgaacgccgtcgcccac
gatccgcagggcctgctggcgcacgtcggcgaacagggcatcacggtgctggaaagcgtg
ccgtcgctgatccagggcatgctcgccgaagagcgccaggccctcgacggcctgcgctgg
atgctgcccaccggcgaggcgatgccgccggaactggcgcgccagtggctcaagcgctac
ccgcggatcggcctggtgaatgcctacgggccggcggaatgctccgacgacgtggcgttc
ttccgcgtcgacctggcctccaccgagagcacctacctgccgatcggcagtcccaccgac
aacaaccgcctgtacctgctcggcgccggcgccgacgacgccttcgaactggtgccgctg
ggcgcggtgggcgagctgtgcgtggccggcaccggcgtcggtcgtggctacgtcggcgat
ccgctgcgcaccgcccaggccttcgtcccgcatccgttcggcgcgccgggcgagcgtctg
taccgtaccggcgacctggcgcggcggcgcgccgacggagtgctggagtatgtcgggcgg
atcgaccaccaggtgaagatccgcggcttccgcatcgagctgggcgagatcgaggcgcgc
ctgcacgaacgcgccgacgtccgcgaggcggcggtggcggtgcaggaaggggagaacggc
aagtacctggtgggctacctggttcccggcgagacaccgcgttccagcgccgactcgccg
gccggactggtggtggagcagggcgcctggttcgagcggatcaagcagcaactgcgcgcc
gacctgccggactacatggtgccgctgcactggctggtgctggaccggatgccgctcaac
gccaacggcaagctcgaccgcaaggcgctgccggcgctggacatcggccagatgcagaac
caggcctaccaggccccgcgcaacgaactggaggaaaccctggcgcggatctgggccgag
gtgctgaaggtcgagcgggtcggggtgttcgacaacttcttcgaactcggcgggcattcg
ctgctggccacccagatcgcctcgcgggtgcagaaggccctgcaacgcaacgtgccgcta
cgggcgatgttcgaatgcaccacggtggaagagctggccagttacatcgagtccctggcc
ccgagcgagatcagcgagcagaaggccgagcgcctgaacgacctgatgtcgaagctggaa
atgctctga

DBGET integrated database retrieval system