KEGG   Pseudomonas aeruginosa RP73: M062_14610Help
Entry
M062_14610        CDS       T02711                                 

Definition
(GenBank) ribonuclease BN
  KO
K07058  membrane protein
Organism
prp  Pseudomonas aeruginosa RP73
Brite
KEGG Orthology (KO) [BR:prp00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    M062_14610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: AGO40387
LinkDB All DBs
Position
3182915..3183814
Genome map
AA seq 299 aa AA seqDB search
MFRTAYREIGLFGLVKRTVNEFLEDDMPTYASALAYQMLFSLFPFLLVLITLVGYLHLPE
FFAWLREQAALLLPPEAMDQVNPVIDQLQQQKGGLLSIGIAVALWTSSAGIRSMMIALNA
AYDVKESRPVWKRFSLSILYTLGIALLLLVAAGLMVTGPQVIAWIAGLVGLEQYLVTLWT
WLRWPLAVFLLMLAVALFYYLVPDVEQRFRFITPGSVLSVIAWIAASLAYGFYVKNFANY
NAMYGSIGAIIILLLYFYLSAAVVLFGAELNAVIEHHSEDGKDPGERELPDNDDPELKA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgttccgtacggcttatcgggaaataggcctgttcggcctggtcaagcgcacagtgaac
gagttcctcgaggacgacatgccgacctacgcctcggccctcgcctatcagatgctgttc
tcgctatttccgttcctgctggtgctgatcaccctcgtaggctacctgcacctgccggag
ttcttcgcctggctgcgcgagcaggcggcgttgctgctgccgcccgaggcgatggatcag
gtcaacccggtgatcgaccagttgcagcagcagaaaggcggcctgctgtcgatcggtatc
gcggtggcgctgtggacctcctcggcgggcatccgctcgatgatgatcgcgctcaacgcc
gcctacgacgtgaaggagagccgcccggtatggaagcgcttctccctgtcgatcctctac
accctcggcatcgccctgttgttgctggtggcggccggcctgatggtcaccgggccgcag
gtgatcgcctggatcgccggcctggtcggtctggaacagtacctggtgacgctctggacc
tggctgcgctggcctcttgcggtgttcctgctgatgctcgcggtggcgctgttctactat
ctggtgccggatgtcgagcagcgtttccgcttcatcactccaggctcggtgctctcggtg
atcgcctggatcgccgcgtccctcgcctatggcttctacgtgaagaacttcgccaactac
aacgccatgtacggcagcatcggggcgatcatcatcctcctgctgtacttctacctgtcg
gcggcagtggtgctgttcggcgccgagctgaacgcggtgatcgaacaccattcggaagac
ggcaaggaccctggcgagcgcgaacttccggacaacgacgaccccgaactcaaggcttga

DBGET integrated database retrieval system