KEGG   Providencia sp. WCHPr000369: CYG50_04915Help
Entry
CYG50_04915       CDS       T05654                                 

Definition
(GenBank) superoxide dismutase [Cu-Zn] SodC1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
prq  Providencia sp. WCHPr000369
Brite
Enzymes [BR:prq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CYG50_04915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AXH61419
UniProt: A0A345LTH9
LinkDB All DBs
Position
751967..752491
Genome map
AA seq 174 aa AA seqDB search
MKLKMCLLAALLTAGTAYAAQSTVVLKEATPTGDGKAIGEVVISETEYGLLFTPKLTGLQ
AGIHGFHIHENPSCEPGEKDGKSVPALKAGGHLDTAKTGVHKGPYDNTGHLGDLPGLVAD
SQGNADYAVLAPRLKSLKDVQDRALMVHVGGDNYSDNPEALGGGGARMACGVIK
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaaaaatgtgtttactggctgcattattgacagcggggacagcatacgctgct
caatctactgttgtattaaaagaagcgaccccaacaggtgatggtaaagcaataggtgag
gttgttatctcagaaacggaatatggattactgttcacgcccaaattaacgggcctgcaa
gctggcattcatgggtttcatattcatgaaaacccaagctgtgaacccggagaaaaagac
ggtaaatcagttccagcattaaaagcaggtggtcatttagacacagctaaaacaggtgtc
cataaaggtccttatgataatacagggcatttaggcgatttacctggcctagttgccgat
agccaaggtaatgctgattatgcggtattagcaccacgtttaaaatcactcaaagatgtt
caagatcgtgcattgatggtgcatgtgggtggtgataactattctgataatccagaagcg
ttaggcggtggtggggctagaatggcctgcggcgtcatcaaataa

DBGET integrated database retrieval system