KEGG   Providencia sp. WCHPHu000369: CYG50_06030Help
Entry
CYG50_06030       CDS       T05654                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
prq  Providencia sp. WCHPHu000369
Brite
KEGG Orthology (KO) [BR:prq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CYG50_06030 (ahpF)
Enzymes [BR:prq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CYG50_06030 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_binding_3 DAO AlaDh_PNT_C FAD_oxidored Thi4 NAD_binding_8 K_oxygenase NAD_binding_7 FMO-like Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AXH61617
UniProt: A0A345LU27
LinkDB All DBs
Position
1416440..1418014
Genome map
AA seq 524 aa AA seqDB search
MLDNNLQAQLKAYLERLTKPVELVANIDDSQKSNEIKQLLEQIASLSDKVTVREERNSAL
RTPSFLITNPGTDSGLRFAGSPLGHEFTSLVLALLQIGGHPSKESQELLEQVKGLEGEFH
FETYYSLSCHNCPDVVQALNLMAVLNPNVSHTAIDGALFQNEIDERNVMGVPAVYLNGKE
FGQGRMTLSEIVSKVDTNADARAAKSLTEREPFEVLVIGSGPAGASAAIYTARKGIRTGV
IGERFGGQVMDTVDIENYISVIKTEGAIFAGALKNHVDSYDVDVIDGQSVTKLIPAAQEG
GLHQIETASGGILKSRSIIISTGARWRNMGVPGEQEYRTKGVTFCPHCDGPLFKGKRVAV
IGGGNSGIEAAIDLAGVVDHVTVLEFAPELKADSVLQQKARSMKNVDIIVNAQTLEVKGD
GSKMTGLEYKDRTDDSVHLLEVAGAFVQIGLLPNTNWLGDTVARNRMGEIEIDARNETSI
KGIFAAGDCTTVPYKQIIISAGEGAKAALSAFDYLIRTSTRTAE
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaataatttacaggcacagttgaaagcctacttagaacgtttaactaaaccc
gttgaattagttgctaatatagatgacagccaaaaatcaaatgaaatcaaacagctgtta
gaacaaattgcctcactgtcagataaagtcactgtacgtgaagagcgcaatagcgcacta
agaacaccgtcttttttaattactaacccaggtacagatagtggtttgcgttttgcaggc
tcacctctgggacatgaatttacctctcttgtgttggcattattgcaaatcggtggtcat
ccatcgaaagaatcgcaagagttattagagcaagttaaaggccttgaaggcgaattccac
tttgaaacttattactctttatcttgccataactgcccagatgttgttcaagctctgaac
ttaatggcagttttaaatccaaatgttagtcataccgccattgatggcgcgcttttccaa
aacgagattgatgaacgtaatgtcatgggcgttccagcggtttacctgaatggaaaagag
tttggtcaagggcgtatgacactcagtgagattgtgagcaaagttgacacgaatgccgat
gcgcgtgcagcgaaatcactgacagagcgcgagccttttgaagtcctcgtgattggtagt
ggcccagcaggggcttcagcagcaatctatactgcacgtaaagggatccgcacaggcgtg
ataggcgagcgttttggtggccaagtcatggatacggttgatattgaaaactatatttcc
gttatcaaaacggaaggcgctatttttgcaggtgcgttgaagaaccatgtggacagctat
gatgttgatgttattgatgggcagtcagtgacaaaattgatcccagctgcgcaagaaggt
ggtttacaccaaatcgaaacagcatcaggcgggatcttaaaatcacgcagtattattatt
tcaacgggtgctcgctggagaaatatgggcgttccaggggaacaagaataccggacgaaa
ggtgttacattctgcccacactgcgatggcccattatttaaaggcaagcgtgttgccgtg
attggcggtggtaactcaggtattgaagcggctattgacctagcgggtgtcgttgaccat
gtgactgtactggagtttgcaccagaactgaaagcggactcagtattacagcaaaaagca
cgtagcatgaaaaatgtggatattatcgttaatgcgcaaaccttagaagtaaaaggtgat
ggcagtaaaatgaccggccttgagtataaagaccgcactgatgatagcgtacatttattg
gaagtggcgggggcattcgtacaaatcggtttattgcctaataccaattggttaggcgac
accgttgccagaaaccgtatgggcgaaattgaaattgacgctcgtaacgaaaccagtatt
aagggtatttttgctgctggtgactgtactacagtaccttataagcaaattattatttca
gccggggaaggggccaaagccgcacttagcgcatttgactacctcatccgcacaagtacc
agaaccgctgaatag

DBGET integrated database retrieval system