KEGG   Providencia sp. WCHPr000369: CYG50_08035Help
Entry
CYG50_08035       CDS       T05654                                 

Definition
(GenBank) erythritol/L-threitol dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
prq  Providencia sp. WCHPr000369
Brite
KEGG Orthology (KO) [BR:prq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CYG50_08035
Enzymes [BR:prq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     CYG50_08035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AXH61970
UniProt: A0A345LV30
LinkDB All DBs
Position
complement(1360300..1361412)
Genome map
AA seq 370 aa AA seqDB search
MCEHCDSKATMSAGIPEKMKAVVAYAPKDYRLETVDVPKISEEEILVRVEACGICAGDVK
AFEGAPSFWGDAEQPAYIKAPMIPGHEFIGHVVGFGSKVEGFALGDRVISEQIVPCWECR
FCKRGEYWMCEKHDLYGFQNNVNGGMAQYMKFTKEAINYHVPVEMPIEDAILIEPYACSL
HAVQRANVKLGDVVVLSGAGTLGLGMIGAIKKSGAGKLVVLDLFDKRLELAKEFGADIVL
NPKRDDVDKIVKEMTEGYGCDIYIEATGAPKSVEQGLKMIRKLGTFVEFSVFKDPVTVDW
SIISDRKELDLLGSHLGPYCYPLVIEGIGNGDFPTKGVVTDILPLDKFAEGFSMMAKGDP
HIKVVLDPNL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaacactgtgattcaaaagcaacgatgagcgcaggcattccagaaaaaatgaaa
gccgtggttgcttatgcaccaaaagactaccgtttagaaactgtcgatgtccctaaaatt
agtgaagaagaaattttggttcgcgtagaagcttgtggtatctgcgcgggtgatgtgaag
gcttttgaaggtgctcctagtttttggggtgatgcagaacagcccgcttatatcaaagcg
ccaatgatcccagggcatgaatttattggccatgttgtaggctttggctcaaaagttgaa
ggttttgcattaggtgaccgtgttatttctgagcaaatcgtaccttgttgggaatgccgc
ttttgtaaacgcggtgaatactggatgtgtgaaaaacatgacttgtatggcttccaaaac
aatgtgaatggcggtatggcgcaatatatgaagttcaccaaagaagccatcaactaccat
gtgcctgttgagatgccaatcgaagatgccattttgattgaaccttacgcctgttcttta
catgccgtgcagcgcgctaatgtcaagttgggtgatgttgtcgtgctttcaggggctgga
acattaggtctcggtatgattggagcgattaaaaaatcgggtgctggtaagttagtcgtt
ctggatttatttgataaacgccttgaattagcaaaagaatttggtgccgatatcgtatta
aaccctaaacgtgatgatgtagacaaaattgtcaaagagatgactgaaggttatggctgt
gacatttacattgaagctactggggcgcctaaatcggtagagcaaggccttaagatgatc
cgtaaattaggtacttttgttgagttttctgtatttaaagacccagtgaccgtggactgg
agcatcatcagtgaccgtaaagaactggatttattaggttctcaccttggcccatattgc
tacccattagtgattgaaggtattggtaatggcgatttcccaaccaagggggttgtgacg
gatattttacctttagataaatttgcggaaggtttttcgatgatggcgaaaggcgacccg
cacattaaagtggttctcgacccgaacctgtag

DBGET integrated database retrieval system