KEGG   Providencia sp. WCHPr000369: CYG50_08045Help
Entry
CYG50_08045       CDS       T05654                                 

Gene name
tkt
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
prq  Providencia sp. WCHPr000369
Pathway
prq00030  Pentose phosphate pathway
prq01100  Metabolic pathways
prq01110  Biosynthesis of secondary metabolites
prq01120  Microbial metabolism in diverse environments
prq01130  Biosynthesis of antibiotics
prq01200  Carbon metabolism
prq01230  Biosynthesis of amino acids
Module
prq_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
prq_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:prq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CYG50_08045 (tkt)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    CYG50_08045 (tkt)
Enzymes [BR:prq01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     CYG50_08045 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N TPP_enzyme_C E1_dh NAAA-beta
Motif
Other DBs
NCBI-ProteinID: AXH61972
UniProt: A0A345LV32
LinkDB All DBs
Position
1362225..1364234
Genome map
AA seq 669 aa AA seqDB search
MSTQPQNKLANAIRFLSIDAVQQANSGHPGAPMGMADIAEVLWRDYLQHNPADPHWPNRD
RFVLSNGHASMLLYSLLHLTGYELSIDDLKQFRQLHSKTPGHPELGYTPGVETTTGPLGQ
GIANAVGMAIAEKTLAATFNRSGFPVVDHYTYTFLGDGCLMEGISHEVCSLAGTLKLNKL
IAFYDDNRISIDGDVEGWFTDNTAKRFEAYGWHVIRSINGHSRPAIKAAIEQARQQTSKP
TLIICRTTIGYGSPNKAGTADSHGAPLGQDEITLTRQQLGWAYPPFVIPDEIYQPWNALE
RGAEQQLRWEQALREYAKQYPELAEQLTQRLSNQLPEKFTDIIDNFIQQLNDNPATIATR
KASQNTLNIIGPVLSELIGGSADLAPSNLTYWSGSQPINEQPSGNYIHYGVREFGMTAIA
NGIALHGGFRPYTATFLMFSEYAQNAVRMAALMKLPQILIYTHDSIGLGEDGPTHQPVEQ
LVSLRATPNLSVWRPCCQVETAVAWKQAIIHQQKPTALVLSRQNLIQYSRTAEQLANIAR
GGYILRSNSETPELLLIATGSEVTLAVEAWKQLTEQGFHVNVISMPSTDTFDQQPLEYQQ
RVLPNHVRHRIAIEASISDYWRKYVGIDGLVMGMNSFGESAPASKLFEYFGFTVEKLITM
SRSLLKPND
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtccactcaaccacaaaataaattagccaatgccattcgatttctttcaatagatgcc
gtacaacaagccaattcaggccaccctggagccccaatgggaatggctgatattgctgaa
gttctttggcgagattatttacagcacaaccccgcagacccacattggcctaaccgtgac
cgctttgtattatcaaacggccatgcctcaatgctgctctatagtttgcttcatttaaca
ggctatgagttatccattgatgatttaaaacagttccgacaactccattccaaaacaccg
ggtcaccctgaattaggctatacccccggtgttgaaaccacgacaggcccgctggggcaa
ggtatcgccaatgcggttggtatggcaatcgcagaaaaaaccctagcggctacgtttaat
cgctcggggttccccgttgttgaccactatacctatacatttttaggtgatggctgttta
atggaagggatctcccatgaagtgtgttcattagcaggaacattaaaactcaataaactc
attgcgttttatgatgacaaccgcatttctattgatggagatgtggaaggctggtttacc
gataataccgcaaagcgttttgaagcctatggctggcatgtaattagatcaattaatggg
cattcgcgccctgcgattaaagcggctatcgaacaagcacgccaacaaacctcgaaaccc
acactcattatctgcagaaccacgattggttatggttcgcccaataaagccggtaccgca
gattctcatggtgctcctctcggacaagatgaaataacactgactcgccaacaactcggt
tgggcgtatccgccttttgtgatccctgatgaaatataccaaccttggaatgccttagaa
cgtggtgctgaacagcaattacgttgggaacaagcactacgagaatacgccaaacaatac
ccagaactcgcagagcaactaacgcaacgattatccaatcaactccctgaaaaatttaca
gatatcattgataacttcattcaacaattaaatgataacccggcaacgatagctacacgt
aaagcgtcacaaaatacactcaatattattggtcctgttttatctgaattaatcggtggc
tccgcagacttagccccaagcaacctgacttattggtctgggtcacagccaattaatgaa
caaccttcaggcaactatattcactatggcgtcagagagtttggtatgaccgccattgcc
aatggcattgcattacatggcggttttcgcccttacacggcaactttcttgatgttctct
gaatatgcacaaaatgccgtgagaatggctgcgttaatgaaattgccacaaattcttatt
tatactcacgattcaattggcttaggtgaagatggtccaacacaccaacccgttgagcaa
cttgtttcgctgcgtgccacgcctaatttgtcggtatggcgcccttgttgccaagtagaa
accgctgtggcttggaaacaggctatcattcatcaacaaaagccaactgcacttgtatta
tcccgccaaaatctaattcaatattcacgaacagccgaacagctcgctaatattgcgcgt
ggtggatatattttgcgcagcaatagtgagacgcctgaattactattaattgctactggt
tctgaagtcacattagcggttgaagcatggaagcaactgactgaacaaggttttcatgta
aatgttatttcgatgccatcaacagatacctttgaccaacaacccttagagtaccagcag
cgcgttttgccaaatcatgttcgccatcgtattgctatcgaagccagtattagtgattac
tggcgtaaatatgtagggattgatggattagttatgggaatgaacagttttggagaatca
gcccctgcaagtaaattgtttgaatattttgggtttaccgtagaaaagcttattactatg
tcacgttcattattaaaacctaatgattaa

DBGET integrated database retrieval system