KEGG   Providencia sp. WCHPr000369: CYG50_10315Help
Entry
CYG50_10315       CDS       T05654                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
prq  Providencia sp. WCHPr000369
Pathway
prq00020  Citrate cycle (TCA cycle)
prq00190  Oxidative phosphorylation
prq00650  Butanoate metabolism
prq01100  Metabolic pathways
prq01110  Biosynthesis of secondary metabolites
prq01120  Microbial metabolism in diverse environments
prq01130  Biosynthesis of antibiotics
prq01200  Carbon metabolism
Module
prq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
prq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
prq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:prq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CYG50_10315
   00650 Butanoate metabolism
    CYG50_10315
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CYG50_10315
Enzymes [BR:prq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CYG50_10315
    1.3.5.4  fumarate reductase (quinol)
     CYG50_10315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_18 Fer4_7 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: AXH62388
UniProt: A0A345LW98
LinkDB All DBs
Position
complement(1855343..1856059)
Genome map
AA seq 238 aa AA seqDB search
MKLQFSIYRYNPDVDNAPRMQDYTLEVPEGRDMMLLDALIQIKEQDPTLSFRRSCREGVC
GSDGLNMNGKNGLACITPLSALIRGGKKIVIRPLPGLPVVRDLIIDMTQFYTQYEKIRPY
LINDNKNPPARENLQTPAQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETDSRLDDLNDAFSVFRCHSIMNCVNVCPKGLNPTKAIGHIKSMLLKHSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacaattttcgatttatcgctacaatcctgatgtggacaacgcaccacgtatg
caagattacacgctagaagttcctgaagggcgtgacatgatgttgctggatgcgttaatc
caaatcaaagagcaagacccaacactctctttccgtcgttcttgtcgtgaaggggtatgt
ggttccgatggcctgaacatgaacggtaaaaacgggttggcgtgtattacgccattatct
gctttaatccgtggtgggaagaaaattgtcattcgtccattaccgggtctgcctgttgtg
cgtgacctgattatcgatatgactcagttttatacccaatacgaaaaaattcgtccatat
ctgattaatgataacaagaacccaccagcgcgtgagaatttacaaactcctgcacaacgt
gaaaaactcgatggtttatatgagtgtattttgtgtgcttgttgttcgacttcttgccca
tcgttttggtggaatccagacaagtttatcgggcctgcaggcttgttggcagcgtatcgc
ttcttaattgatagccgtgatactgaaaccgattcacgattagatgatctgaacgacgct
tttagtgtcttccgctgtcatagcatcatgaattgtgtcaatgtatgccctaaagggcta
aatccaacgaaagctatcggtcatattaaatctatgttactaaaacatagcgcttaa

DBGET integrated database retrieval system