KEGG   Providencia sp. WCHPr000369: CYG50_10320Help
Entry
CYG50_10320       CDS       T05654                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
prq  Providencia sp. WCHPr000369
Pathway
prq00020  Citrate cycle (TCA cycle)
prq00190  Oxidative phosphorylation
prq00650  Butanoate metabolism
prq01100  Metabolic pathways
prq01110  Biosynthesis of secondary metabolites
prq01120  Microbial metabolism in diverse environments
prq01130  Biosynthesis of antibiotics
prq01200  Carbon metabolism
Module
prq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
prq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
prq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:prq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CYG50_10320
   00650 Butanoate metabolism
    CYG50_10320
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CYG50_10320
Enzymes [BR:prq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CYG50_10320
    1.3.5.4  fumarate reductase (quinol)
     CYG50_10320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like Thi4 FAD_binding_3 DAO FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AXH62389
UniProt: A0A345LW99
LinkDB All DBs
Position
complement(1856095..1857861)
Genome map
AA seq 588 aa AA seqDB search
MNLPIREFDAIVIGAGGAGMRAALQISQMGLSCALLSKVFPTRSHTVSAQGGITVALGNT
HPDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGSIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGDVVGC
TAICMETGELVYFKAKATILATGGAGRIYQSTTNAHINTGDGVGMAARAGVPLQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKDVLESRLPGILELSRTFAHVDPIKEPIPVIPTCHYMMGGI
PTKVTGQALRYNEKGEDEVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRSAGLHLK
ESIMEQGSMRDASESDIDAAMTRFNRWEGARTGEDPTEIRKALQTCMQHNFSVFREGDAM
AKGLEELKVIRERLQNARLDDTSTEFNTQRIECLELDNLMETAYATAQAANFRTESRGAH
SRFDYPERDDANWLCHSLYLPQSETMTRREVNMQPKLREAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgccaatcagagagtttgacgctatcgttatcggtgcgggtggcgcaggtatg
cgcgcagcacttcaaatttcacagatgggcctatcttgtgcgcttctgtcaaaagttttt
ccaactcgttctcatactgtatcagcgcaaggtggtatcacggttgctttaggtaacacg
catcctgataactgggaatggcacatgtatgacactgttaaaggttccgactacatcggt
gaccaagacgctatcgaatacatgtgtaaaacagggccagaggctatcctcgaattagaa
catatggggttaccgttctcgcgccttgatgatggaagtatttatcaacgtccatttggt
ggtcagtctaaaaacttcggtggtgagcaagctgcgcgtactgcagctgcagctgaccgt
actggccatgcactgttacataccttgtatcagcagaacttaaaaaaccacacaaccatt
ttttctgaatggtatgcccttgatttagttaaaaaccaagacggcgatgttgtaggttgt
actgcaatttgtatggaaacaggcgaactggtttatttcaaagcgaaagcaactatttta
gcaacgggtggtgcgggtcgtatttaccaatcaaccactaacgcacacatcaatacgggt
gatggcgtgggaatggctgctcgtgcaggtgttccactgcaagatatggaaatgtggcaa
ttccaccctacggggatcgctggcgcgggtgttctcgtgacagaaggttgtcgtggtgaa
ggtggttacctgttgaataaagacggcgagcgtttcatggagcgttatgcgccgaacgcg
aaagaccttgcgggtcgtgacgttgttgcgcgctcaatcatgattgaaattcgtgaaggt
cgtggttgtgatggcccatggggtccacacgccaagctgaaactggatcacttaggaaaa
gacgttctggaatctcgtttaccgggtatccttgaattatctcgtacctttgctcacgtt
gacccaatcaaagagccaatccctgttattcctacctgtcattacatgatgggcggtatt
ccaacgaaagtgacgggtcaagctctgcgttataacgaaaaaggcgaagatgaagtcatt
cctggtctgtttgcggtcggtgaaattgcctgtgtatcagtacatggtgctaaccgctta
gggggtaactcacttctcgacttagtggtatttggtcgctcagcgggtctgcatttgaaa
gaatccattatggagcaaggttcaatgcgtgatgcatctgaatctgatattgatgcagcg
atgacacgttttaaccgttgggaaggtgcgcgtacgggtgaagacccaactgaaatccgt
aaagcactgcaaacctgtatgcagcataacttctcggtattccgtgagggtgatgcaatg
gcgaaaggtttagaagagctgaaagtgatccgtgagcgtctgcaaaatgcacgccttgat
gatacttcgactgaatttaatactcagcgtatcgaatgtttagaactggataacctgatg
gaaacggcttatgcaacggcacaagctgcaaacttccgtacagaaagtcgtggtgcgcat
agccgctttgactacccagagcgagatgatgcgaattggttatgtcactcattatattta
ccgcaatctgaaacgatgacgcgtcgtgaagtcaacatgcagccaaaactgcgtgaagcc
ttcccaccgaaaattcgtacctactaa

DBGET integrated database retrieval system