KEGG   Providencia sp. WCHPr000369: CYG50_17160Help
Entry
CYG50_17160       CDS       T05654                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
prq  Providencia sp. WCHPr000369
Pathway
prq00250  Alanine, aspartate and glutamate metabolism
prq00410  beta-Alanine metabolism
prq00430  Taurine and hypotaurine metabolism
prq00650  Butanoate metabolism
prq01100  Metabolic pathways
prq01110  Biosynthesis of secondary metabolites
prq01120  Microbial metabolism in diverse environments
prq02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:prq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CYG50_17160
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CYG50_17160
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CYG50_17160
   00430 Taurine and hypotaurine metabolism
    CYG50_17160
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CYG50_17160
Enzymes [BR:prq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CYG50_17160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AXH63613
UniProt: A0A345LZS3
LinkDB All DBs
Position
complement(3351711..3353111)
Genome map
AA seq 466 aa AA seqDB search
MSNNALNSKYNGIDDVYASLELSKSLPKTKFPLKEQAPRNVFSAVRDELMLDGNSRQNLA
TFCQTWVDDEIRDLMDLSIDKNMIDKDEYPQTAEIENRCVHMLADLWNSPEAENTLGCST
IGSSEAAMLGGLALKWQWRKKQAAKGKPTDKPNLICGPVQICWHKFARYFDVELREIPLE
GDRLIMTPEEVLKRVDENTIGVVPTLGVTFTCQYEPVKAVHDALDKLQKETGLDIPIHVD
GASGGFLAPFCAPDLEWDFRLPRVKSINASGHKFGLAPLGAGWVVWREAKDLPEELIFNV
NYLGGNMPTFALNFSRPGGQIIAQYYNFLRLGREGYAKIHNACYATAQYLSREIEKLGPF
EMIFDGNSQTGIPALAWKLKEGTTTSKYSLYDIADKLRSRGWQVPAYSMPANREDLVIQR
ILVRHGVSLDLAALLIDDFKRTLEYFDKHPVNNPLTEEEGGGFNHS
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataatgcattaaattcaaaatacaatggaatagatgatgtctatgcatcatta
gaattatccaaatcgttaccgaaaaccaaatttccattgaaagaacaagcaccacgtaat
gtatttagtgcagtacgcgatgaattaatgttagatgggaattcacgccaaaacttagca
acattctgccagacatgggtggatgatgaaattcgtgatttaatggacttatctatcgac
aaaaacatgatagataaagacgaatatccacaaacagcagaaattgaaaaccgctgcgta
catatgttagcggacttatggaattcaccagaagcagaaaatacccttggttgttcaacc
atcgggtcctcagaggctgcaatgcttggggggctcgcgttaaaatggcaatggcgtaaa
aaacaggctgctaaagggaaaccaaccgataaacccaacttaatttgtggcccagttcaa
atctgttggcacaaatttgcccgttacttcgatgttgagctcagagagatcccactggaa
ggtgaccgtctcatcatgacaccggaagaagtgctcaagcgtgtcgatgaaaacaccatt
ggtgtcgtgccaacgctaggggtgacatttacctgccaatatgagcccgtaaaagcggta
cacgatgcgctcgataaactgcaaaaagagacgggtctggatattcctatccatgtggat
ggtgcgagtggcgggttcttagccccattttgtgctcccgatttagaatgggacttccgc
ttaccacgggtaaaatccattaatgcatcaggccataaatttggtttagccccattaggc
gctggctgggtagtttggcgtgaagccaaagaccttcccgaagaattgatttttaatgtg
aattatttaggcggtaacatgccaacattcgcactgaatttctctcgccctggcggtcaa
atcattgctcaatattataatttcttgaggctaggccgcgaaggctatgcaaaaatccac
aacgcttgctatgcaaccgcacaatacctcagccgtgaaattgaaaaattagggccattt
gaaatgatttttgatggtaatagccaaacgggtatccctgcactagcatggaaactgaaa
gaaggcacaaccaccagcaaatattccctctatgatatcgcagacaaactgcgtagtcgc
ggctggcaagttcctgcctattcaatgccagcaaaccgtgaagatcttgttattcaacgt
attctagtgcgtcatggcgtcagtttagatttagccgcattactcattgatgacttcaaa
cgtacattagagtatttcgataagcaccccgtcaataacccgctaacggaagaagaaggc
ggcggctttaatcacagttaa

DBGET integrated database retrieval system