KEGG   Providencia sp. WCHPr000369: CYG50_22595Help
Entry
CYG50_22595       CDS       T05654                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
prq  Providencia sp. WCHPr000369
Pathway
prq00473  D-Alanine metabolism
prq00550  Peptidoglycan biosynthesis
prq01100  Metabolic pathways
prq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:prq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CYG50_22595
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CYG50_22595
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CYG50_22595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:prq01011]
    CYG50_22595
Enzymes [BR:prq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CYG50_22595
Peptidoglycan biosynthesis and degradation proteins [BR:prq01011]
 Precursor biosynthesis
  Amino acid ligase
   CYG50_22595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 RimK ATPgrasp_ST ATP-grasp_3 TTL ATPgrasp_Ter ATPgrasp_YheCD ATP-grasp Csa1
Motif
Other DBs
NCBI-ProteinID: AXH64601
UniProt: A0A345M2L1
LinkDB All DBs
Position
4508971..4509891
Genome map
AA seq 306 aa AA seqDB search
MTEKVAVLLGGSSAEREVSLQSGNAVLAGLRQAGIDAHPIDPQDFPVETLKDAGFNKVFI
ALHGRGGEDGTLQGLLETLNLPYTGSGVMACALSMDKLRTKQLWQGAGLSVSPYVYLTKQ
QYKQASREQIVAKVQLLGLPLIVKPSLEGSSVGMSKVDSLEALPAALDLAFQFDETLLIE
KWLSGPEFTVAVLGDNALPSIRIQPPGIFYDYEAKYLSDETQYFCPSGLGEQLESELTDL
ALKAYQVVGCEGWGRVDVMQDNDGQFYLLEVNTSPGMTSHSLVPMAARQAGMSFSQLVVQ
ILKLAR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacagagaaagttgcggttctattagggggctcatccgctgaacgtgaggtttcactt
cagtcaggaaatgctgtgctggcggggttacgccaagcaggcattgatgctcatcctatt
gacccccaagatttccctgtagaaacactgaaagatgcaggtttcaataaagtttttatt
gcattacatggccgtggtggtgaagacgggacattgcaagggctgctagaaacattaaat
ctgccttataccggcagtggtgttatggcttgtgcacttagcatggataagctgagaaca
aaacaattatggcaaggtgcagggctaagtgtgtcgccatatgtttacttaacaaagcag
cagtataagcaggcttctcgtgaacaaattgttgctaaagtacaattgctagggttaccg
ctcattgtgaagccgagcctagaaggctcaagtgttggcatgagtaaagttgatagctta
gaggcattgcccgctgcattggatctcgcgtttcaatttgatgaaacattgttaattgaa
aaatggttgagtggccctgagttcacggttgcagtgttgggagataacgctctgccgtca
attcgtattcaaccaccgggtattttttatgattacgaagcgaaatatttatctgatgaa
acccaatacttttgcccaagtggcctaggtgaacagctcgagtctgaactcacagactta
gcgctgaaagcataccaagttgttggctgcgaaggttggggacgagttgatgtaatgcaa
gataacgatggtcaattttatctgctggaagttaatacatcgccaggtatgacaagccat
agcttagtaccgatggcagctcgtcaagcggggatgagtttttcacagttagttgtacaa
attttgaaattggctcgttga

DBGET integrated database retrieval system