KEGG   Pseudoalteromonas rubra: AT705_01040Help
Entry
AT705_01040       CDS       T04179                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
prr  Pseudoalteromonas rubra
Brite
Enzymes [BR:prr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     AT705_01040
Peptidases [BR:prr01002]
 Metallo Peptidases
  Family M2
   AT705_01040
Exosome [BR:prr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT705_01040
CD molecules [BR:prr04090]
 Proteins
  AT705_01040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 CENP-O
Motif
Other DBs
NCBI-ProteinID: ALU41627
UniProt: A0A0L0EXF6
LinkDB All DBs
Position
1:complement(225097..226908)
Genome map
AA seq 603 aa AA seqDB search
MALQFKLSLGALVVAGALSLSGCNSTSTSTLTEKDAEAFLTKAEKDLQDLSYRSARSAWI
YANFITEDTASLAADVSQEYTEKLVALANEAAKFDELELSYDNRRKLDKLKLNLTLPAPK
DAAKTAELAKLSAELDGMYGKGKYCKDGNCMSLGEMTSKMANSRNYDELLDVWQGWRQVS
PQMRPLYKDLVSLANEGAQELGYRDTGAMWRSKYDMPADDFAKELDRIWGQVKPLYDSLH
CHVRAKLGEKYGEDKVPQDQPIPAHLLGNMWAQQWGNIYDLVAPENADPGYNVTELLEQH
NYDEIKMVKGAEKFFTSMGFEPLPETFWTRSLFTKPQDRDVQCHASAWNLDNKDDLRIKM
CIQRTGEEFSVIHHELGHNFYQRAYNKLPLYYQESANDGFHEAIGDTIALSVTPGYLKEI
GLLEQVPDESKDIGLLMKMALDKIAFIPFGLLVDQWRWKVYSGEISPAEYNQAWWELREK
YQGLQAPVTRSENDFDPGAKYHVPGNVPYTRYFLAHILQFEFHKALCEIAGNKEAIHRCS
VYNSKEAGERLNAMLEMGSSRPWQEALESVTGSQQMDATAILDYFAPLQTYLDEQNKNRQ
CGW
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggcactacaattcaaactcagcctgggcgccctcgtggttgccggggcactctctctg
agtggatgtaactcaacaagcacgtcaaccctgaccgaaaaagacgctgaagcattttta
accaaagcagaaaaagacctgcaggacctgagctatcgcagtgcacgttcagcctggatc
tatgccaacttcattacagaagacacggcatcactggccgctgacgtaagccaggaatac
actgaaaaactagtcgcattggccaatgaagcagctaagtttgacgaacttgagctaagt
tacgacaatcgtcgtaaactcgacaagctgaaacttaacctgacattaccagcgccaaaa
gacgcggccaaaacggctgagctggctaagctatcggcagagctggacggtatgtacggt
aaaggtaaatactgtaaagacggcaactgcatgagtctgggtgaaatgacatccaaaatg
gccaacagccgaaactacgatgaactattggacgtatggcaaggctggcgtcaggtttct
cctcaaatgcgccctctgtataaagacttagtgtctttggcaaatgaaggtgctcaggag
ctggggtatcgcgatacaggcgcaatgtggcgcagcaaatacgatatgcccgcggatgat
ttcgccaaagaacttgatcgtatctggggtcaggtaaaaccgctttatgactcattgcat
tgtcatgttcgcgcaaagcttggcgaaaagtacggcgaagacaaagtaccacaagatcag
ccaatcccggcacacctgctaggtaacatgtgggcacaacagtggggtaacatctatgat
ctggtcgcacctgaaaatgccgatccgggttataacgtcactgaactgctagagcagcat
aattacgatgaaatcaagatggtaaaaggtgctgagaagttctttacttcaatgggcttt
gaaccactgccagagaccttctggactcgttcattattcaccaaaccgcaagatcgtgac
gtacagtgtcatgcgtcagcctggaacctggataacaaagacgatctgcgtattaagatg
tgtatccagcgcactggtgaagaattctccgttattcaccacgagttaggccataacttc
tatcaacgtgcttacaacaaactgccgttgtattatcaggaaagtgccaacgatggtttc
catgaagctatcggtgacaccattgctctgtcagtcacgcctggttacctcaaagaaatc
ggtctgttagagcaagtaccagatgaatcgaaagacattggtctgttgatgaaaatggcg
cttgacaaaattgctttcattccatttggcctgctagttgaccagtggcgctggaaagtg
tactccggtgaaatcagcccggcagaatacaatcaggcctggtgggaattacgtgaaaag
tatcaaggtcttcaggcacctgttacacgtagcgaaaacgactttgacccaggtgcaaaa
tatcacgtaccaggcaatgtaccttacacacgttacttccttgcacacattttgcaattt
gaattccacaaagcactatgtgaaattgctggtaacaaagaagccattcatcgttgttca
gtttacaactcgaaagaagcgggcgagcgcttaaatgccatgcttgaaatgggcagcagc
cgtccatggcaagaagcactggaaagcgtcactggcagtcagcaaatggacgcaaccgct
atcctggattactttgcaccacttcagacttatctggatgagcaaaataaaaaccgccag
tgcggttggtaa

DBGET integrated database retrieval system