KEGG   Pseudoalteromonas rubra: AT705_02195Help
Entry
AT705_02195       CDS       T04179                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
prr  Pseudoalteromonas rubra
Pathway
prr00500  Starch and sucrose metabolism
prr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AT705_02195
Enzymes [BR:prr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AT705_02195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ALU41837
UniProt: A0A0U2P425
LinkDB All DBs
Position
1:517467..519860
Genome map
AA seq 797 aa AA seqDB search
MKKLSSLTLALIAAGLVGCGSANNAVESQQAAPGAPGDKPYWAYSGKTGIGTSYEAYEQG
QYSDEASTETVSKVWFSIAKGMITETMFGLIHQAQIKDMQFIVTGPDFTVTEQDALDVSI
DYLDKDAQGRPLSLAYKVISKDKQGRFTLEKYIFTDPDGQTLFVRAKVETELNDVKLFVN
VNPYVNNNGLNDFAKVTDEGLVAWEGDNYLTLQSSNGFKQASVGFTGQSDGLAQLKASQS
MSQRYTNTGVQSGNVNWLAELGDVDQQATFDLALSFGKSQSASFQQGAQSLKRGYHQVLA
HYNGEGDTIGWRDYLSSLEPMQKLSGYTADQGKLLYTSALVLKAQEDKTHAGALIASLSN
PWGDTVAAEQGHTGYKAVWVRDFYQVAMAFLAMGDPKTALTAFEYLEKVQVTDKTPGNQG
DTGWFLQKTHVDGELEWVGVQLDQTAMPIMLAWKLWQAGVLSDEKLVHWYKRMLQPAAEF
LVEGGLAKILWNDTQITPPATQQERWEEQNGYSPSTTAAIIAGLVAASDIAKLAGDKAGS
ERYMVTAKRYDSEVESTMFTTKGNLPSKQSDGKYFVRIGKDANPNTDTKLSDNNGRSGLD
KKQIIDGGFLELVRYGVRAADASSITNTLPEYEDENLPENLRVKYSFNFAGDPNSYPGYR
RYGNDGYGEDEIRGTNYAEQGQNTAGQRGRVWPFFTGERGHYEIAAASQVNALNDTAVQR
IKYTYIKGMEHFANEGLMLPEQVWDGVGVNPFGYTLGEGTNSATPLAWTHAEYVKLVRSL
ADKQVWDHYPIVEQALK
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactttctagtttaactctggcattgattgccgccggacttgttggttgcggc
agcgcgaataacgcggttgagtcacagcaggctgcgccgggcgcaccgggtgataagcca
tactgggcctattcaggtaaaaccgggattggtacctcttatgaggcctacgagcaaggg
cagtattctgatgaggcaagtacagaaaccgtttccaaagtgtggttttctattgccaaa
ggcatgatcacagaaactatgtttggcctgatccatcaggctcagatcaaagacatgcag
tttattgtcaccggcccggattttacggtaacggagcaagacgcactggacgtcagtatt
gattacctggacaaagacgcacaaggtcgtccgctgtctttagcatacaaagttatcagc
aaagacaagcaaggccgttttacgcttgaaaaatacatattcaccgaccccgacgggcaa
accttgttcgttcgcgcgaaagtggaaactgaactgaatgatgtgaagttgtttgttaac
gtaaacccgtacgtaaataataacgggttgaatgactttgctaaggtaacggacgagggt
ctggttgcctgggaaggagacaactacctgacattgcaaagcagcaatggttttaaacag
gcgagtgttggctttactggtcaaagcgatggtctggcgcagcttaaggcaagtcagtca
atgtcacaacgctacaccaataccggtgtacaaagcggcaacgttaattggttagcagag
ctgggtgacgttgaccagcaggccacattcgacctggcactgagttttggcaaatcgcaa
agcgcgagtttccagcagggcgctcagtcacttaagcgtggctatcaccaggtattggcc
cactacaacggtgagggcgatacgattggctggcgcgattacctgagtagccttgagcct
atgcagaagctcagcggttatacggccgatcagggaaaactactttataccagtgctttg
gtgttaaaggcgcaggaagataaaacccatgctggagcgctcattgcgtccttgtctaac
ccttggggtgacacggttgcagccgagcaaggtcataccggttataaagcggtctgggta
cgcgatttctatcaggtggctatggcatttttggccatgggtgacccaaaaacggcattg
actgcgtttgaatatctggaaaaagtacaagttaccgataaaacgcctggcaatcagggt
gacacgggctggttcttacagaaaacccatgttgacggtgagctggagtgggttggtgtg
caactggatcagactgctatgccaattatgctggcatggaaactttggcaggccggtgtg
ctgagcgatgagaagcttgtccattggtacaagcgcatgttgcaacccgcagctgagttt
ttggtagaagggggtctggccaaaatcctctggaacgatacgcagatcacgccaccagca
acacagcaggagcgttgggaagagcagaatggctattcaccttcgacaacggccgctatt
attgcagggttagtcgcggccagtgatattgccaaactagcaggcgataaagcgggcagt
gagcgctatatggttacggctaagcgatacgacagtgaagtagaatccaccatgttcacc
acaaagggcaacttgccgtctaagcaaagtgatggcaagtactttgtccgaattggtaaa
gatgcaaatccgaatacagatactaagctgagtgacaacaatggtcgttcaggtttggat
aagaagcagatcattgatggtggcttccttgagttagtacgctatggtgtaagagccgct
gatgccagtagcatcactaatacgttaccagagtatgaagatgaaaacctgcctgagaat
ctgcgcgtaaaatatagctttaactttgccggcgacccgaatagttatccgggctaccgc
cgttatggcaacgacggttacggtgaagacgaaatacgtggcacgaactatgccgagcag
ggtcagaacacggccggtcagcgtggtcgggtttggcctttctttaccggtgagcgcggc
cactacgagatagcggcagccagccaggttaatgccttgaatgacactgcggtgcaacgt
atcaagtacacttacatcaaaggcatggagcattttgccaacgaaggtctgatgctccct
gagcaggtctgggatggcgtgggcgtaaacccgttcggttatacactgggcgagggcact
aactctgccacaccgttggcatggacacatgctgagtatgtgaagctggttcgctctttg
gcagacaagcaagtctgggatcattatccaattgtggagcaggcgcttaagtaa

DBGET integrated database retrieval system