KEGG   Pseudoalteromonas rubra: AT705_06900Help
Entry
AT705_06900       CDS       T04179                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
prr  Pseudoalteromonas rubra
Pathway
prr00550  Peptidoglycan biosynthesis
prr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AT705_06900
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:prr01002]
    AT705_06900
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:prr01011]
    AT705_06900
Enzymes [BR:prr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AT705_06900
Peptidases and inhibitors [BR:prr01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   AT705_06900
Peptidoglycan biosynthesis and degradation proteins [BR:prr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AT705_06900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase CytoC_RC
Motif
Other DBs
NCBI-ProteinID: ALU42709
UniProt: A0A0L0EQM8
LinkDB All DBs
Position
1:1559733..1560896
Genome map
AA seq 387 aa AA seqDB search
MTVFKPKFIKHLVGAVCSFTLFSASAQILPSPPQVSAKGYFLVDFTTGKVIAEGNPDTKL
APASLTKMMTSYVIGTELLAGNISNDDMVTVSEKAWAKNFPESSKMFIEVGKQVSVKDLN
YGVIIQSGNDACVAMAEHIAGSESAFTDLMNAHAEKLGMSNSHFANSHGLDSTEQFTTPR
DMATLGAALIRDVPEEYAIYKEKSFTFNGIKQYNRNSLLWDASLDVDGIKTGHTSEAGYS
LVTSATKGDMRLIAVVMGTASERARKVESKKLLNYGFRFFETITPYKAGDSFADQRIWMG
NKETVSLGIAQDTPITIPRGQRKNLKAHFELDKTLEAPLAKGSKVGTLFLQLEGEDIAQY
PLVTLEEVEEGSFFSKIYDYLRLQIMQ
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgacagttttcaaacctaaatttattaaacacttagtgggtgccgtgtgttcgttcacc
ctgttttcggccagcgcgcagatcttaccgtcgccgcctcaggtcagtgctaagggctat
ttcctggtcgactttaccacaggtaaggtcattgccgagggtaacccggacaccaaactg
gcaccggccagtctgaccaaaatgatgaccagctatgtgattggtactgagctgttagcc
ggtaatatctccaacgatgacatggttaccgtgagtgaaaaagcgtgggcaaagaacttc
ccggaatcttctaagatgttcatcgaagtgggtaaacaggtcagcgttaaagatttgaac
tatggcgtaatcatccaatcgggtaacgatgcctgtgtggccatggccgagcatatcgcg
ggcagtgaaagtgccttcaccgatctgatgaacgcccatgccgaaaaactggggatgagc
aattcgcactttgccaatagtcatggtctggacagcactgagcagttcaccacaccaaga
gatatggcgaccctgggtgccgcactgatccgtgacgtgccagaagagtatgccatctac
aaagagaaatcgttcacctttaatggtatcaagcaatacaaccgtaactcgctactgtgg
gatgccagcctggacgtcgacggaattaaaaccggtcacacctcagaagccggctacagc
ctggtgacttctgcgaccaaaggtgatatgcgtctgattgccgttgtcatgggcacagcc
agtgaacgcgcccgtaaggtcgagagtaaaaagctcctgaactacggtttccgtttcttc
gaaaccatcacgccttataaagcaggcgacagctttgccgaccagcgcatctggatgggt
aacaaagaaacggtttctctgggtattgcccaggatacaccgatcaccattccacgtggt
cagcgtaaaaacctcaaagcccacttcgagctggacaaaaccctcgaagcgccactggcg
aaaggcagcaaggtcggtactttattcttgcaactggaaggggaagacatcgctcaatac
ccactggttacacttgaagaagtggaagaaggcagcttcttcagcaagatttacgactac
ttacgtttacagatcatgcaataa

DBGET integrated database retrieval system