KEGG   Pseudoalteromonas rubra: AT705_09445Help
Entry
AT705_09445       CDS       T04179                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
prr  Pseudoalteromonas rubra
Pathway
prr00250  Alanine, aspartate and glutamate metabolism
prr00410  beta-Alanine metabolism
prr00430  Taurine and hypotaurine metabolism
prr00650  Butanoate metabolism
prr01100  Metabolic pathways
prr01110  Biosynthesis of secondary metabolites
prr01120  Microbial metabolism in diverse environments
prr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:prr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AT705_09445
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT705_09445
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT705_09445
   00430 Taurine and hypotaurine metabolism
    AT705_09445
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AT705_09445
Enzymes [BR:prr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AT705_09445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 Hydant_A_N UPF0175 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ALU43146
UniProt: A0A0U3GE84
LinkDB All DBs
Position
1:complement(2141357..2142985)
Genome map
AA seq 542 aa AA seqDB search
MGPKRCAVASEESLMRIFTVPEAPSSTLSVIEQEISSNLAGFLNENIAAIEKPLHEIEKD
FQSAMIPEEPMFVSDYAQDIMEQLVAHSVHTASPSFIGHMTSALPHFVLPLSKLMVGLNQ
NLVKIETSKAFTPLERQVLGMMHHLAYGEDDAFYEKWMHSAKTALGAFCSGGTIANISAL
WIARNRLLGPDGDFKGLASEGIMAAMLHYGYKGLAVLVSERGHYSLGKAADVLGIGRSNF
IAVKTDENNKVDVEAMRAKAQTLREQGIKVMAIVGVAGTTETGNIDPLPEMAALAQDLGC
HFHVDAAWGGATLLSANYRHLLKGIELADSITIDAHKQMYVPMGAGIVLFKDPTATDAIE
HHAEYILRKGSKDLGSHTLEGSRPGMAMLVHACLRVIGRKGYEMLIDKGIEKAHYFAELI
REEDDFELVSEPELCLLTYRYVPKQIRQAIEQADEQERIDIYAALNRFTASMQKRQRESG
RSFVSRTRLTPSQYQYQPTVVFRVVLANPLTSKQMLKEILAEQKGLAQSDPVFKKYLAKY
MA
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgggtccaaagcgttgtgcagtcgcttctgaagaaagcttaatgcgtatctttaccgtt
ccagaagcacccagctccacgttaagtgtaatagagcaggaaatttccagtaatctggcg
ggctttctgaatgaaaatatcgcagcaattgaaaaaccattgcatgagatagaaaaagac
tttcagtcggcaatgatcccggaagaaccgatgtttgtctctgactatgcccaggatatt
atggagcagttggttgcacattccgtgcataccgcgtcgccaagctttatcgggcatatg
acctcagcgctgccgcattttgttctgccgttgtcaaagctgatggtcggtttgaatcag
aacctggtaaaaatagaaacttcaaaggcctttacgccattggagagacaggtgctgggc
atgatgcatcaccttgcttatggtgaagatgacgccttctatgaaaaatggatgcacagt
gccaaaaccgcactcggcgcattttgctctgggggtaccattgccaatatttcggcgttg
tggattgcccgcaaccgattgcttggtccggatggtgacttcaaagggcttgccagtgaa
gggatcatggctgccatgctgcattatggatacaaaggcctggccgtgttggtgtctgag
cgtggtcactattcattgggtaaagcggccgatgtattgggcattgggcgcagtaacttt
attgccgttaaaactgatgagaacaataaggttgacgttgaggcaatgcgcgctaaggca
cagacgctgcgtgagcagggcattaaggtcatggcgattgttggcgtggccggtactact
gaaacgggcaacatagatcccttacccgaaatggcggcgctggctcaggacctgggatgt
cattttcacgttgatgcagcctggggcggtgcaactttgttgtcagcgaattaccggcat
ttacttaagggcattgagttggctgattcaatcaccattgatgcgcacaagcaaatgtat
gtgccaatgggcgcaggtattgtattgtttaaagatcccaccgcaacagatgcgatagaa
caccacgcggagtacattctgcgtaaagggtcaaaagacctgggtagtcatacacttgag
ggcagccgccctggtatggccatgctggttcatgcatgtttacgggtgatagggcgtaaa
gggtatgaaatgctgatcgacaaaggcattgaaaaagcccactattttgcagagctgatc
cgcgaggaagacgactttgagttggtctctgaaccggagctatgcctgctgacctatcgc
tatgtgccaaaacagatccgccaggcgattgaacaagccgatgagcaggaacgcattgat
atctatgcggcgctgaaccgatttactgccagtatgcagaaacgccagcgtgaatcaggc
cgctcttttgtatcacggacgcgcttaaccccttcgcaatatcagtatcagcctaccgtg
gtattcagagtggtgttagccaatcctctgacctcaaagcagatgctaaaagagattctg
gcagaacaaaaagggctggcgcagagcgatccggtctttaaaaagtacctggcaaaatac
atggcttag

DBGET integrated database retrieval system