KEGG   Pseudoalteromonas rubra: AT705_10070Help
Entry
AT705_10070       CDS       T04179                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
prr  Pseudoalteromonas rubra
Pathway
prr00473  D-Alanine metabolism
prr00550  Peptidoglycan biosynthesis
prr01100  Metabolic pathways
prr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:prr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AT705_10070
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AT705_10070
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AT705_10070
Enzymes [BR:prr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AT705_10070
Peptidoglycan biosynthesis and degradation proteins [BR:prr01011]
 Precursor biosynthesis
  Amino acid ligase
   AT705_10070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 ATP-grasp GARS_A ATPgrasp_Ter RimK
Motif
Other DBs
NCBI-ProteinID: ALU43256
UniProt: A0A0U3HQL2
LinkDB All DBs
Position
1:complement(2278261..2279169)
Genome map
AA seq 302 aa AA seqDB search
MNKFGKVAVLLGGLSAEREVSLKSGQAIINALEETGVDVVPFDPAERNLWELKSLQVDRV
FIALHGRGGEDGTVQGALEFMGLPYTGSGVLGSALAMDKIRCKQLFESAKLSTARYCVVT
AAQEIDTTALMAKFGKVMVKPSHEGSSIGMTQATSAQELQAALTEAFKYDDEILIEQWID
GREFTVAMLGEEALPVIEMRTPRGFYDYQAKYQVNSTEYYCPADINTAYTEQLQVMAKHA
FELVGATGWGRVDAMQDGNGQFYLLEVNTVPGMTEKSLVPMAAKQNGLSFKQLVIRILEQ
TL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaataagtttggcaaagtcgcggtgttgctgggtggcttgtctgctgagcgagaagtg
tcgttaaagtcaggtcaggcaattatcaatgcactggaagaaacgggtgttgacgtggtg
ccatttgatccggctgagcgtaatttgtgggagctaaaaagcctgcaagtggaccgggta
tttattgctttgcatggccgtggtggtgaagatggcactgtacagggggcgctggaattt
atgggcttgccctataccggcagtggcgtgttgggcagtgcactggcgatggacaagatc
cgctgcaaacaattgtttgagtctgccaagttgagtacggctcgttattgtgtggtcacg
gcggcacaagaaatcgataccacggcactgatggctaagttcggaaaggtcatggttaag
cccagccatgaagggtcaagcataggtatgactcaggcgacgtcggcgcaggagctgcaa
gccgcgcttactgaagcatttaagtacgatgatgaaattctgattgaacaatggattgac
ggccgcgagtttaccgttgccatgctaggggaagaggcattacctgtgatagaaatgcgc
acacctcgagggttctatgactatcaggctaagtatcaggtcaacagtacggagtactat
tgcccggcagacatcaatacggcgtacactgagcagttacaggtgatggccaaacatgct
ttcgagctggtaggcgcaactggctggggacgagtggatgcgatgcaagatggcaatggc
caattttatttgttggaagtgaatacagtccccggcatgacagaaaaatcactggtgccg
atggccgcgaagcaaaacgggttgtcatttaagcaattagttattcgcattttggagcaa
accctttaa

DBGET integrated database retrieval system