KEGG   Planococcus rifietoensis: AUC31_06555Help
Entry
AUC31_06555       CDS       T04201                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
prt  Planococcus rifietoensis
Pathway
prt00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:prt00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AUC31_06555
Enzymes [BR:prt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AUC31_06555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Cellulase Glyco_hydro_14 Glyco_hydro_2_C LBP_M DUF4434 DUF3821 Cyc-maltodext_C
Motif
Other DBs
NCBI-ProteinID: ALS74905
UniProt: A0A0U2N4J5
LinkDB All DBs
Position
432134..434164
Genome map
AA seq 676 aa AA seqDB search
MINDKLPKIWHGGDYNPEQWDSQEIWDEDVRMFKLAGIDVATLNVFSWALNQPNEDTYNF
DWLDDKINRLYENGIYTCLATSTAAHPAWMAKKYPDVLRVDFYGRKRKFGSRHNSCPNSP
TYREYSEKIADKLAERYKDHPAVLIWHVSNEYGGYCYCDNCQDAFRVWLSDKYGTLEKLN
KAWNTGFWGHTFYEWDEIVAPNILSEEREDNVSDFQGISLDYRRFQSDSLLDCYKLEYNA
IRKHTPNIPITTNLMGTYPMLDYFKWAKEMDVVSWDNYPAIDTPFSYTAMTHDLMRGLKS
GQPFMLMEQTPSQQNWQPYNSLKRPGVMRLWSYQAIGRGADTILYFQLRRSVGACEKYHG
AVIEHVGHENTRVFNEVAQIGSEFNQLGDTLLDARVNAKVAIVFDWENRWATELSSGPSV
SLDYVNEVHKYYDALYKLNVQVDMVGVEEDLSQYDVVIAPVLYMVKEGYAAKVERFVENG
GTFITTFFSGIVNETDIVTLGGYPGELRKVLGIWAEEIDALHPDETNEIVVNGSRGSLSG
SYSCNLLFDLIHTEGAQAVAEYGSDFYQGMPVLTVNEFGKGKAWYVASSPDAEFLVDFLQ
TVCEEAGVEPLLSVPQGVETTERVKDGQTYLFVLNHNNKAESIDLKDSQYKELLTAQQLS
GRVELEAKGVFILAKV
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacgataaattgccgaagatttggcacggcggggactataacccggaacaatgg
gattcacaagaaatctgggacgaagatgtgcgcatgttcaagcttgctggcatcgacgtc
gctacgttaaacgtcttttcatgggcgctcaatcagccgaacgaagacacatacaacttc
gactggctcgatgacaaaatcaaccgcttgtacgaaaacggcatttatacatgcctcgct
acaagcacggcagcgcatcctgcgtggatggcgaaaaaatatccggacgtcttgcgcgtt
gatttctacggcagaaaacgcaaattcggcagccgccacaactcgtgcccgaatagcccg
acttaccgcgaatattccgagaaaatcgccgacaaactagccgagcgctacaaagaccat
cctgcggtcttgatttggcatgtgtcgaacgaatacggcggctattgctattgtgataat
tgccaggatgctttccgcgtttggctgagcgataaatatggcacgcttgaaaagctcaac
aaagcttggaacactggattctggggccacacattctacgaatgggacgaaatcgtcgcg
ccgaatatcctcagcgaagagcgtgaagacaacgtttcagacttccaagggatttctctt
gattaccgccgcttccagtcggacagcctgcttgattgctataagctcgaatacaacgca
atccgcaagcatacgccaaacatcccgatcacgacgaatttgatgggcacgtatccgatg
ctcgattatttcaaatgggcaaaagaaatggacgttgtgtcgtgggataactacccggcg
atcgatacgccgtttagctatacggcgatgacgcacgatttgatgcgcggtttgaagagc
gggcagccgttcatgctgatggagcagacgccgagccagcaaaactggcagccgtacaac
tccttgaagcgcccgggcgtcatgcgcttgtggagctaccaggcaatcggccgcggggcg
gatacgatcctttatttccaactgcgtcgttcagtcggagcatgcgagaaataccacggc
gcagtcattgaacacgtgggacatgaaaatacgcgcgtctttaacgaagtggcgcaaatc
ggcagtgagttcaaccagttgggcgatactttgctcgatgcgcgggtcaacgccaaagtc
gcaatcgtctttgattgggaaaaccgctgggcgacagaactgtcgagcggaccgtccgtg
tcgctggattatgtcaatgaagtccataaatactacgacgcgctgtataaattaaacgtc
caagtcgacatggtcggcgtcgaagaagacttgagccaatacgatgtcgtcatcgcgccg
gtcttgtatatggtgaaagaaggctacgcagcaaaagtcgagcgtttcgtcgaaaacggc
ggcacgttcatcacgacgttcttcagcggcatcgtcaacgaaaccgatatcgtcacactc
ggcggctacccgggcgaattgcgcaaagtgctcggcatttgggcagaggaaatcgacgcg
ctgcatccggacgaaacgaatgaaatcgtcgtgaacggatcacgtggaagcttaagcggc
agttattcctgcaatttgctgttcgacttgatccacacagaaggcgcgcaagcagtcgct
gaatacggctctgatttctaccagggcatgccggtcctcaccgtcaatgagttcggaaaa
ggaaaagcctggtatgtggcctcgagcccagacgcagagttcttggtcgatttcctgcaa
accgtatgcgaagaagcaggcgtcgagcccttgctttctgttccgcaaggcgtcgaaacg
accgaacgcgtcaaagacggccagacctatttgttcgtattgaatcacaacaacaaagca
gaatcgatcgacttgaaagacagccagtataaagaactgctgactgcacagcaattgagc
gggagagtggaactcgaagcaaaaggcgtcttcattttagcgaaagtataa

DBGET integrated database retrieval system