KEGG   Planococcus rifietoensis: AUC31_07540Help
Entry
AUC31_07540       CDS       T04201                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
prt  Planococcus rifietoensis
Pathway
prt00473  D-Alanine metabolism
prt00550  Peptidoglycan biosynthesis
prt01100  Metabolic pathways
prt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:prt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AUC31_07540 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AUC31_07540 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AUC31_07540 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:prt01011]
    AUC31_07540 (ddl)
Enzymes [BR:prt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AUC31_07540 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:prt01011]
 Precursor biosynthesis
  Amino acid ligase
   AUC31_07540 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 GARS_A ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ALS75077
UniProt: A0A0U2ZCY3
LinkDB All DBs
Position
211931..213001
Genome map
AA seq 356 aa AA seqDB search
MKKRIGLLYGGKSAEHEVSLTTASAFSKALDFDKYEVYPIYITQEGEWRKGTPLAGPVSS
IEELQIEGEAERKNDISSFLPNGQEPALDVIIPLLHGPNGEDGTVQGLLEVMNLPYVGNG
VLASSAGMDKVVMKQLFEQAGLHQTPYVYFLRRDWKNSQDLWLDKVEQELTWPVFVKPAN
LGSSVGISKAESREELIAAVEEALKFDRKIVIEQGVVGREIEVGVLGNDEPECSVAGEIK
PLKAFYDYQAKYKDGNTAMIIPAELPEAVYAELVDSAKKAFKILDCTGLVRADFFVTDAH
EIIINEVNTLPGFTPYSMFPLLWQHTGLEYPDLIEKLIALAIERFEEKQLLQFKMD
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgaattgggcttttatacggcggcaaatccgctgaacacgaagtatcgttg
acaacagcgagcgcattctctaaagcgcttgattttgataaatacgaagtttacccgatc
tacatcacacaagaaggcgaatggcgaaaaggtactcctttagctgggcctgtttcttct
atagaagagcttcaaattgaaggggaagcggaacgtaaaaacgatatctccagtttcctt
ccaaatggccaagaaccggcgctcgacgtcatcattccgctgctccacgggccgaacgga
gaagacggcacggtacaaggtttgctcgaagtgatgaatttgccgtatgtcggaaacggc
gttcttgcatcatcagcaggcatggacaaagtcgtcatgaagcaattgttcgaacaagcc
ggtctgcaccagacaccttacgtctatttcctgcgccgcgattggaaaaacagccaggat
ttgtggttggataaagtcgagcaggagttaacgtggccagtattcgtcaagccggcaaac
ctcggttcaagtgtcggcatcagcaaagccgaatcgcgtgaagaactgattgccgcggtg
gaagaagcacttaaattcgaccggaagatcgtcattgaacaaggcgtcgtcggccgtgaa
atcgaagtcggcgtgctcggcaacgatgagccggaatgctcggtggcaggtgaaatcaaa
ccgttgaaagctttctatgattaccaggcaaaatacaaagatggcaacacggcgatgatc
atcccggcagaactgccggaagcggtatatgcagaactcgtcgattctgcaaaaaaagcg
ttcaagatcctcgattgcacagggcttgttcgcgcagactttttcgtgaccgatgcacat
gaaatcatcatcaacgaagtcaataccttgccgggctttacgccgtatagcatgttcccg
ctgttgtggcagcataccggccttgagtatccggacctgatcgagaaacttatcgcactt
gctattgaacgttttgaagaaaaacaattattgcaatttaaaatggattga

DBGET integrated database retrieval system