KEGG   Planococcus rifietoensis: AUC31_07845Help
Entry
AUC31_07845       CDS       T04201                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
prt  Planococcus rifietoensis
Pathway
prt00071  Fatty acid degradation
prt00280  Valine, leucine and isoleucine degradation
prt00281  Geraniol degradation
prt00362  Benzoate degradation
prt00592  alpha-Linolenic acid metabolism
prt01100  Metabolic pathways
prt01110  Biosynthesis of secondary metabolites
prt01120  Microbial metabolism in diverse environments
prt01130  Biosynthesis of antibiotics
prt01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:prt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AUC31_07845
   00592 alpha-Linolenic acid metabolism
    AUC31_07845
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AUC31_07845
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    AUC31_07845
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AUC31_07845
   00642 Ethylbenzene degradation
    AUC31_07845
Enzymes [BR:prt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     AUC31_07845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt MycE_N
Motif
Other DBs
NCBI-ProteinID: ALS75133
UniProt: A0A0U2YQS5
LinkDB All DBs
Position
149612..150763
Genome map
AA seq 383 aa AA seqDB search
MKEVVIVEGVRSPVGRRKGQFRETRPDELAAVVLEELVNRAGVDKGMVEDVILGCVSQSG
EQGGNIARTAALIAGFPDFVPGVTIDRQCGSSQQAVHFGAQAILSGDMDIVIAGGVESMT
RVPMFSNMQGSKPSKKLTDQYEIINQGLSAERIAEKWGFSREQLDAYAVKSHERAQHAID
AGLYDKEIVSIDVSDEQGDFQKVTTDEGPRPGTTEDVLAGLKPAFDEQGVITAGNASQMS
DGASAVLLMSKEKAQELGLKPKARILARTVVGSDPTLMLTGPIAATKKVLEKAGLSIEDM
DRYEVNEAFAPVPLAWLSDIGGDPDKLNVNGGAIALGHPLGATGTKLLVSLVHELERSNS
RYGLLAICEGMGMANATIIERII
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagtcatcgttgaaggtgtccggtcgccagtcggccggcgaaaagggcaa
ttccgggagactcgaccggacgaactggcagctgtcgtgctagaagaattggtgaaccga
gccggtgtcgataaaggcatggtcgaagatgttattctgggctgcgtctctcaatcgggt
gagcaaggcggcaatattgccagaacggcggcattgattgccggattcccggactttgtg
ccgggcgtcaccatcgaccgccaatgcggatcgagccagcaagccgttcattttggtgca
caggcgattctttcgggcgatatggacattgtcattgcgggtggtgtggaaagcatgacg
cgcgtcccgatgttctccaatatgcaaggatcaaagccgagtaaaaaactgacggatcaa
tacgaaatcatcaatcaagggctgtcggcagaacgtattgcagaaaaatggggcttcagc
cgcgagcaactggatgcttatgcagtaaagagccatgaacgtgcgcagcacgcgatcgat
gcagggctttacgacaaggaaatcgtctcaattgatgtatcggatgaacaaggtgatttc
cagaaagtcacgacagatgaagggccaaggcccggaacgaccgaagacgtgcttgccggc
ttaaagccagcattcgatgaacaaggcgtcatcacagcaggcaacgccagccaaatgagc
gatggggcatccgctgttttattgatgtcaaaagaaaaagcgcaggaacttggcttaaaa
ccgaaagcgcgcatacttgcccgcacggttgtggggtcagatccgactttgatgctgacg
gggccgatcgccgcgacgaaaaaagtactggagaaagcgggactgtcaatcgaagatatg
gaccgctatgaagtgaatgaagcatttgcgcctgttccgctcgcgtggctatcggatatc
gggggagatccggacaagctcaatgtcaacggcggtgctattgcactgggacatccttta
ggtgcgaccggcacgaaattattggtatcgcttgtgcatgaattggaacgctctaatagc
cgctacggcttgctggcgatttgcgaaggcatgggaatggccaatgcaacgatcattgaa
cggatcatttaa

DBGET integrated database retrieval system