KEGG   Planococcus rifietoensis: AUC31_10560Help
Entry
AUC31_10560       CDS       T04201                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
prt  Planococcus rifietoensis
Brite
KEGG Orthology (KO) [BR:prt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AUC31_10560
Enzymes [BR:prt01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AUC31_10560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored AlaDh_PNT_C DAO Thi4 FAD_binding_3 NAD_binding_8 K_oxygenase Glutaredoxin Thioredoxin_4 FMO-like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ALS75609
UniProt: A0A0U2N5R4
LinkDB All DBs
Position
3132013..3133560
Genome map
AA seq 515 aa AA seqDB search
MILDAQIKSQLEQYLQLLEGDVLLQVSAGSDKVSTDMIDLVEELSAMSPRIQMERTKLER
TPSFSVTRPGEEIGITFAGIPLGHEFTSLVLALLQVSGRTPKADAKTMDQIKALEGTYHF
ESYISLSCQNCPEVVQSLNLMSVLNPNITHTMIDGAAFKEEVERKDIMAVPTVFLNGESF
ASGRMSLEELLAKLGSAPDASEFEGKEPFDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVMDTLSIENFVSVKHTEGPKFAASLEEHVKEYDIELMNLQRAKRLEKKELFELELE
NGAVVKGKTVILSTGARWRNIGVPGEEEFKNKGVAYCPHCDGPLFAGKDVAVIGGGNSGV
EAAIDLAGITNHVTVLEYNAELKADSVLQDRLKSLPNVTVLTNARTQEITGTDKVNGLSY
IDLQTGEEKHVELSGVFVQIGLVPNTDWLGDFVERTAHGEIVIDQRGATNMPGVFAAGDC
TNIPYKQIIISMGSGATASLSAFDHLIRSDIPVLV
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgatactagatgcgcaaatcaaatctcaattagagcaatacttgcagctattggaaggc
gacgtgctgctccaagtgagcgccggatccgataaggtatcaacagatatgatcgacttg
gtagaagaactgtctgccatgtctccgcgcattcaaatggagcgcacgaagcttgagaga
accccaagcttcagcgtcacccgtcctggagaagaaatcggcatcacattcgctggcatc
ccgctcggccatgagtttacgtcgctcgtccttgccctattgcaagtgagcggacgcacg
cccaaagccgacgcgaaaacaatggatcagatcaaagcgctcgaaggcacttaccatttc
gaatcctatatcagcctgagctgccagaactgcccggaagtcgtgcaatcccttaatttg
atgagcgtccttaacccgaacatcacgcacacgatgatcgacggcgctgccttcaaagaa
gaagtcgaacgcaaagacatcatggctgttccgacggtatttctaaacggcgaatcgttc
gcaagcggacgcatgtcgcttgaagaattgctcgcgaaactcggcagcgcgccggatgca
tccgaattcgaaggcaaagagccatttgacgtgctcgttgtcggcggcggcccggccggt
gccagcgcagcgatctatgcggcgcgtaaaggcatccgcacaggcattgtcgcggagcgc
ttcggcggccaggtgatggataccttaagcatcgagaacttcgttagcgtcaagcacaca
gaaggcccgaaatttgcggcaagcctcgaagagcatgtgaaggaatacgatatcgagctg
atgaacttgcagcgtgcgaaacgcttggagaaaaaagagctgttcgagcttgaactcgaa
aacggcgctgtcgtcaaaggcaagaccgtcattctttcaacaggtgcccgctggcgcaat
atcggcgttcctggcgaagaggaattcaagaacaaaggcgtggcgtattgcccgcattgc
gacggtccgttatttgccggcaaagacgtcgcggtgatcggcggcggcaattccggcgtc
gaagcggcgatcgaccttgcaggcatcacgaatcacgtgacggtgctggaatacaacgca
gagcttaaagcggattccgttttgcaggaccgcctgaagagcctgccaaacgtcacggtg
ctgacgaatgcacgcacacaggaaattaccggcaccgataaagtgaacggcctttcctat
atcgaccttcaaaccggcgaagaaaagcatgtcgaactatccggcgtcttcgtccaaatc
ggcctcgtgccaaacaccgactggctcggtgacttcgtcgagcgcacagcgcacggcgag
atcgtcatcgaccagcgcggcgcaacgaatatgccgggcgtgtttgcggcaggcgactgc
acgaacatcccgtacaaacagatcatcatttcgatgggctctggcgcaacggcttcactg
agcgcgttcgaccaccttatccgaagcgatatccctgttttagtgtaa

DBGET integrated database retrieval system