KEGG   Planococcus rifietoensis: AUC31_11445Help
Entry
AUC31_11445       CDS       T04201                                 

Definition
(GenBank) bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
prt  Planococcus rifietoensis
Brite
KEGG Orthology (KO) [BR:prt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:prt01002]
    AUC31_11445
Enzymes [BR:prt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     AUC31_11445
Peptidases [BR:prt01002]
 Metallo Peptidases
  Family M4: thermolysin family
   AUC31_11445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: ALS75773
UniProt: A0A0U2YSF6
LinkDB All DBs
Position
2954285..2955943
Genome map
AA seq 552 aa AA seqDB search
MSKKKLLTLSLAASLALSATAVSADTLSKQATEKVHVNKDTQTPDFISGTLTEPSDQDAK
EIVFTYLEENEDTYKIDKKDLSSFKVISQETDDLGFTKVKLQQKFKGVPVFGSVINAHVD
QDGVLTSISGNLAPELYDKKSLKKGATLKAGAAVEKAAADLEEKIGSSPELEAEVTPELV
IYSKDGQAHFAYSAEFEFLYPEPGNYQYFVDAKTGDILDSYNQIHEAKPSGGGSSLTGED
STATGKGVLGDTKSFNTLVNSSGSYLVDRTRGSGIFTYDAKNRTRTPGTLWLDSDNVYNA
AYDGAAVDAHTYAGQTYDYFQDVHSRNSYDGNGAELISTVHYGRSYNNAFWSGSQMVYGD
GDGNTFVPLSGALDVIAHELTHAVTDTSADLIYQNESGAINESMSDIFGTLVEYHFNNKP
DWQVGEDIYTPSVAGDALRSMEDPTLSGDPDHYSKRYTGTGDYGGVHINSGISNKAAFLL
ANGGSHYGVTVAGIGNDKAGDIYYRTLTQYLTPNSNYSHFRVSTIQAATDLYGASSAEVA
SVKAAFSAVGVN
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaagaaattactgactttaagtttggcagcatcactcgcattatccgccaca
gcggtttccgccgataccctatctaaacaggcaacagaaaaagtccatgtcaataaagac
acccagacacctgatttcatttccggaacattgactgaaccgtccgatcaagatgcaaaa
gaaattgtctttacatatttggaagaaaacgaagacacatacaaaatcgataaaaaagac
ctttccagcttcaaagtgatcagccaggaaacagatgatctcggcttcacaaaagtgaag
ctccagcagaaattcaaaggagtgcccgttttcggttccgtgattaacgcccatgttgac
caagacggcgtgctcacgtccatctccgggaatttggcgccggaattgtacgataagaaa
tccttgaagaaaggcgcaaccttgaaagccggggctgcagtcgaaaaagcagcagccgac
ctggaagaaaaaatcggcagttccccagagcttgaagctgaagtgacgccggaattggtc
atctattccaaagacgggcaagcgcattttgcctacagcgctgaattcgagttcctctat
ccggaaccggggaattatcaatacttcgtggatgccaaaacaggcgacatcctcgattcc
tacaaccagatccatgaagcgaagccttccggaggcggttcaagtttgacgggagaagat
tcaacagcaaccggcaaaggcgtattgggcgatacaaaatcgttcaatactttagtcaat
agcagcggttcttacctggtcgaccgtacgcgcggcagcggcattttcacgtacgacgcg
aaaaaccgcacacgtacgccgggtacgctttggctcgacagcgacaatgtctacaacgcc
gcttatgacggcgcagcggtcgatgcccatacttatgctggccagacttacgattacttc
caagacgtccatagccgcaatagctacgacggcaacggcgctgaactgatttccactgtc
cattatggccgcagctataacaatgcgttctggagcggttcccaaatggtttacggcgac
ggtgacggcaataccttcgtgccgctatccggtgcgctggatgtcatcgcgcatgaattg
acgcacgccgtgaccgatacttccgctgacttgatctaccagaacgaatccggcgcaatc
aacgaatcgatgtccgatatttttggaacgcttgtcgaataccatttcaataacaagccg
gactggcaagtgggcgaagacatctatacgccaagcgtcgcgggcgatgcactgcgctcg
atggaagacccgaccttgagcggagacccagatcattattcgaaacgctacaccggcacg
ggtgattacggcggcgttcatatcaactccggcatcagcaataaagcggcgttcctgctc
gccaatggcggctcgcattacggcgtgacggtcgctggcatcggcaacgacaaagcgggc
gatatctactaccgcacactcacgcaatacttgacgccgaactccaactacagccatttc
cgcgtttctactattcaagcggcaacggacctgtacggcgcatcgagcgctgaagtcgca
agcgtcaaagcggcattctcagctgtaggggttaactga

DBGET integrated database retrieval system