KEGG   Planococcus rifietoensis: AUC31_16610Help
Entry
AUC31_16610       CDS       T04201                                 

Definition
(GenBank) transcriptional regulator
  KO
K15973  MarR family transcriptional regulator, 2-MHQ and catechol-resistance regulon repressor
Organism
prt  Planococcus rifietoensis
Brite
KEGG Orthology (KO) [BR:prt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:prt03000]
    AUC31_16610
Transcription factors [BR:prt03000]
 Prokaryotic Type
  Helix-turn-helix
   MarR family
    AUC31_16610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 MarR_2 HTH_24 HTH_34 B-block_TFIIIC
Motif
Other DBs
NCBI-ProteinID: ALS76734
UniProt: A0A0U2YYT7
LinkDB All DBs
Position
complement(1899668..1900111)
Genome map
AA seq 147 aa AA seqDB search
MNEDIKQSLKLFIVLSRAHKAISEQTNQFFQENGVNPTEFAVLELLYHKGRQPLQKIGGK
ILLASGSITYVIDKLEKRGFITRVNCPTDRRITYAEITEEGEAFMADIFPAHEQKIHELT
AALSPEEKEQAIELMKKIGLSIKDLSY
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagacatcaaacagtcgttgaaactgtttatcgttttgtcccgtgcgcataaa
gcgatttcggaacaaaccaatcaatttttccaggagaatggcgtcaatccgacagaattt
gcggtattggagctgctctaccataaagggcgccagccgctgcagaaaattggcggaaaa
atcctgttggccagcgggtcgattacttatgtcatcgacaagttggaaaagcgcggattt
atcacgcgtgtcaattgcccgacggaccgccgcattacttatgcggaaattacggaagaa
ggggaagctttcatggctgacatcttcccggcgcacgagcaaaaaattcacgaactgacg
gctgctttatctcccgaagaaaaggagcaagccatcgaattgatgaagaaaattggcttg
tcgatcaaagatttgtcctattaa

DBGET integrated database retrieval system