KEGG   Prevotella ruminicola: PRU_1201
Entry
PRU_1201          CDS       T01212                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pru  Prevotella ruminicola
Pathway
pru00010  Glycolysis / Gluconeogenesis
pru00030  Pentose phosphate pathway
pru00051  Fructose and mannose metabolism
pru00052  Galactose metabolism
pru00680  Methane metabolism
pru01100  Metabolic pathways
pru01110  Biosynthesis of secondary metabolites
pru01120  Microbial metabolism in diverse environments
pru01200  Carbon metabolism
pru01230  Biosynthesis of amino acids
pru03018  RNA degradation
Module
pru_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PRU_1201 (pfkA)
   00030 Pentose phosphate pathway
    PRU_1201 (pfkA)
   00051 Fructose and mannose metabolism
    PRU_1201 (pfkA)
   00052 Galactose metabolism
    PRU_1201 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    PRU_1201 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    PRU_1201 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pru01009]
    PRU_1201 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pru03019]
    PRU_1201 (pfkA)
Enzymes [BR:pru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PRU_1201 (pfkA)
Protein phosphatases and associated proteins [BR:pru01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PRU_1201 (pfkA)
Messenger RNA biogenesis [BR:pru03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PRU_1201 (pfkA)
SSDB
Motif
Pfam: PFK NAD_kinase
Other DBs
NCBI-ProteinID: ADE82551
UniProt: D5ESB5
LinkDB
Position
complement(1420020..1420997)
AA seq 325 aa
MTKIKTIGILTSGGDAPGMNAAIRAVTRAGIYNGFRIKGIYRGYEGLIHDEVQEFTTENV
SGIVTRGGTILKTARSKEFPTPEGMQKAYETCVKEEIDALVVIGGNGSLTGARNFGMEFD
FPVIGLPGTIDNDLYGTDSTIGYDTTMNTIMECVDRIRDTANSHERIFFVEVMGRDAGFL
AQNSAIACGAEAAIVPEESTDVDQLAQFMSRGIRKSKKSCIVIVSESPKCGALYYADRVK
KEFPEFDVRVSILGHLQRGGTPSARDRILAATTGVGAIEAIKQGQRNVMVGIRNNEVVYV
PFSECIRTDKRFDKRLIKVLDELSI
NT seq 978 nt   +upstreamnt  +downstreamnt
atgacaaagattaagacaattggtatcctgacgtcgggaggcgatgcaccaggaatgaat
gccgctatacgtgctgtgacacgtgccggtatctacaacggttttaggattaaaggtata
tatcgtggttacgaaggactgattcatgatgaggttcaggagtttaccaccgaaaatgta
agtggaattgtgacacgtggcggtactatcctgaagactgcccgctcaaaggagttccca
actcccgagggcatgcagaaggcttacgagacttgtgtaaaggaagagattgatgcgctg
gtagttatcggtggtaacggatcgcttactggtgcccgtaacttcggtatggagttcgat
ttccctgtaatcggtctgcctggtacgattgataacgatttgtatggcaccgattctact
atcggttatgatacaaccatgaataccatcatggagtgtgtcgatcgtatccgtgataca
gccaactcgcatgagcgtatcttctttgtcgaggtgatggggcgtgatgccggattcctg
gcacagaactcggccattgcatgtggtgctgaggctgctatcgtacccgaggagagtacc
gatgtcgaccagctggcacagttcatgagtcgtggtatccgtaaatcaaagaagtcgtgt
atcgtgattgtgtcggagagtcctaagtgtggcgctctgtactatgccgaccgtgtaaaa
aaggagttccctgagtttgatgtacgtgtgtctatcctgggccatctgcagcgtggtggt
acaccatcagcgcgcgaccgcattctggctgctaccacaggtgttggtgctatcgaagcc
atcaaacagggacagcgcaacgtgatggttggtatccgcaataacgaggtggtttatgta
cctttcagcgagtgcatccgtactgataagcgtttcgacaagcgactgattaaggtactc
gacgagctcagcatttga

DBGET integrated database retrieval system